Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.66
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.500 3.2e-06
astrocytic glioma -1.500 1.1e-02
Astrocytoma, Pilocytic -1.300 2.5e-06
atypical teratoid / rhabdoid tumor -1.600 9.6e-05
Breast cancer 1.200 4.8e-04
colon cancer -2.100 6.7e-04
cystic fibrosis 2.133 1.4e-05
diabetes mellitus -1.100 3.2e-03
Down syndrome 1.300 4.9e-03
ependymoma -2.400 1.1e-02
glioblastoma -1.100 1.8e-03
group 4 medulloblastoma -1.800 3.4e-07
intraductal papillary-mucinous adenoma (... -1.400 1.4e-04
intraductal papillary-mucinous carcinoma... -1.400 3.3e-02
intraductal papillary-mucinous neoplasm ... -1.200 3.1e-03
invasive ductal carcinoma -1.200 4.1e-02
lung adenocarcinoma -1.900 1.3e-14
lung cancer 1.700 1.2e-02
lung carcinoma 1.200 2.7e-11
malignant mesothelioma -3.800 9.3e-09
medulloblastoma, large-cell -1.400 1.2e-03
non diabetic and post-ischemic heart fai... 1.100 3.9e-02
non-small cell lung carcinoma -2.100 1.1e-36
oligodendroglioma -1.300 2.1e-02
Pick disease -1.600 1.1e-02
primitive neuroectodermal tumor -1.200 8.5e-03
progressive supranuclear palsy -2.200 4.8e-03
urothelial carcinoma -1.300 2.3e-04

AA Sequence

MPSLPQEGVIQGPSPLDLNTELPYQSTMKRKVRKKKKKGTITANVAGTKFEIVRLVIDEMGFMKTPDEDE      1 - 70
TSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQ     71 - 140
FQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILV    141 - 210
TSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIKWFTEF    211 - 280
LQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEI    281 - 350
NRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPGSSDWEQQR    351 - 420
HQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTFLSGRAASFQR    421 - 490
ELNNPLKRMKEEDILDLLEQCEIDDEKLMGKTTKTRGPKPLCSMPESTEIMKRPKYCSSDSSYDSSSSSS    491 - 560
ESDENEKEEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVS    561 - 630
RPTSASRSHSLNRASSYMRHLPHSNDACSTNSQVSESLRQLKTKEQEDDLTSQTLFVLKDMKIRFPGKSD    631 - 700
AESELLIEDIIDNWKYHKTKVASYWLIKLDSVKQRKVLDIVKTSIRTVLPRIWKVPDVEEVNLYRIFNRV    701 - 770
FNRLLWSRGQGLWNCFCDSGSSWESIFNKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYATDKRGSLSGI    771 - 840
GPDWGNSRYLLPGSTQFFLRTPTYNLKYNSPGMTRSNVLFTSRYGHL                           841 - 887
//

Text Mined References (12)

PMID Year Title