Property Summary

Ligand Count 10
NCBI Gene PubMed Count 9
PubMed Score 15.65
PubTator Score 79.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 1.9e-02
gastric carcinoma 1.100 1.2e-02
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
osteosarcoma 2.149 5.9e-08
ovarian cancer -1.400 2.6e-05
posterior fossa group B ependymoma -1.100 8.4e-05

Gene RIF (1)

AA Sequence

MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADK      1 - 70
LCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQNGIQPPISNSRTDEREFFLASYNRKKE     71 - 140
DGEGNVWIAKSSAGAKGEGILISSEASELLDFIDNQGQVHVIQKYLEHPLLLEPGHRKFDIRSWVLVDHQ    141 - 210
YNIYLYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFFKEFNQYLTSALNITLE    211 - 280
SSILLQIKHIIRNCLLSVEPAISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGI    281 - 350
VDIAISSVFPPPDVEQPQTQPAAFIKL                                               351 - 377
//

Text Mined References (13)

PMID Year Title