Property Summary

NCBI Gene PubMed Count 25
PubMed Score 25.82
PubTator Score 452.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26905105 P-AKT and TTF-1 using IHC had statistically significant correlation with EGFR mutation with high negative predictive value
26823891 Case Report: KRAS mutation-positive bronchial surface epithelium type lung adenocarcinoma with strong expression of TTF-1.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26281863 Immunohistochemical comparison of two TTF-1 mAbs in atypical squamous lesions and sarcomatoid carcinoma of the lung, and pleural malignant mesothelioma suggest possibility for diagnostic errors.
26036188 Overexpression of Transcription Termination Factor 1 is Associated with Colorectal Cancer
25982999 Low expression levels of TTF-1 is associated with lung adenocarcinoma.
25878335 Combined genomic and proteomic analyses demonstrated infrequent alteration of validated lung cancer targets but identified novel potential targets for TTF1-negative LUAD, including KEAP1/Nrf2 and DNA repair pathways
25722034 results indicate that TTF-1 expression in NECs suggests a possible role in their normal development and differentiation
20513429 Depletion of TTF-I recapitulates the effects of ARF on ribosomal RNA synthesis and is rescued by the introduction of a TTF-I transgene.

AA Sequence

MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQHLISSPLKKS      1 - 70
RICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFRKDVDVVCVDMSIEQKLPRKP     71 - 140
KTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWESQRARDTLPQSESHQEESWLSVGPGGEITEL    141 - 210
PASAHKNKSKKKKKKSSNREYETLAMPEGSQAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKK    211 - 280
KKSNHQEFEALAMPEGSQVGSEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMP    281 - 350
ESLESAYPEGSQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD    351 - 420
SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDAD    421 - 490
LGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFSVKENKQLEKNVEDFLALTGI    491 - 560
ESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPWKLIYYRAKKMFDVNNYKGRYSEGDTEKLKM    561 - 630
YHSLLGNDWKTIGEMVARSSLSVALKFSQISSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSK    631 - 700
LQENPESCLSIVREKLYKGISWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIE    701 - 770
RLYEINVEDTNEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE    771 - 840
KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQGRWII         841 - 905
//

Text Mined References (35)

PMID Year Title
26905105 Dual surrogate markers for rapid prediction of epidermal growth factor receptor mutation status in advanced adenocarcinoma of the lung: A novel approach in resource-limited setting.
26823891 2015 KRAS mutation-positive bronchial surface epithelium (BSE)-type lung adenocarcinoma with strong expression of TTF-1: a case providing a further insight as for the role of TTF-1 in the oncogenesis.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26281863 2016 An immunohistochemical comparison of two TTF-1 monoclonal antibodies in atypical squamous lesions and sarcomatoid carcinoma of the lung, and pleural malignant mesothelioma.
26036188 2015 Overexpression of Transcription Termination Factor 1 is Associated with a Poor Prognosis in Patients with Colorectal Cancer.
25982999 2015 The expression of TTF-1 and Napsin A in early-stage lung adenocarcinoma correlates with the results of surgical treatment.
25878335 2015 An Integrated Molecular Analysis of Lung Adenocarcinomas Identifies Potential Therapeutic Targets among TTF1-Negative Tumors, Including DNA Repair Proteins and Nrf2.
25722034 Co-expression of TTF-1 and neuroendocrine markers in the human fetal lung and pulmonary neuroendocrine tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23787483 2013 A mutation in TTF1/NKX2.1 is associated with familial neuroendocrine cell hyperplasia of infancy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20513429 2010 The ARF tumor suppressor controls ribosome biogenesis by regulating the RNA polymerase I transcription factor TTF-I.
20448178 2010 A draft sequence of the Neandertal genome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19487567 2009 Transcription termination by nuclear RNA polymerases.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11532953 2001 NoRC--a novel member of mammalian ISWI-containing chromatin remodeling machines.
11250901 2001 Acetylation of TAF(I)68, a subunit of TIF-IB/SL1, activates RNA polymerase I transcription.
10504331 1999 The mitotically phosphorylated form of the transcription termination factor TTF-1 is associated with the repressed rDNA transcription machinery.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7597036 1995 Molecular coevolution of mammalian ribosomal gene terminator sequences and the transcription termination factor TTF-I.