Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 1.2e-12
tuberculosis and treatment for 6 months 409 1.5e-05
astrocytic glioma 2597 6.5e-03
ependymoma 4679 1.1e-02
oligodendroglioma 2850 1.7e-02
osteosarcoma 7950 3.2e-02

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 6.5e-03
Breast cancer 1.100 1.2e-12
ependymoma -1.100 1.1e-02
oligodendroglioma 1.100 1.7e-02
osteosarcoma 1.001 3.2e-02
tuberculosis and treatment for 6 months -1.200 1.5e-05

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTT      1 - 70
QTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPK     71 - 140
DANVRRYLQLTQSELSSYHRKEKQLYLGMFG                                           141 - 171
//

Text Mined References (8)

PMID Year Title