Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.47
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.600 2.6e-05
astrocytic glioma -2.500 1.2e-03
Astrocytoma, Pilocytic -1.500 1.1e-03
atypical teratoid / rhabdoid tumor -2.800 8.1e-05
colon cancer 1.900 5.4e-05
ductal carcinoma in situ 1.600 2.4e-02
ependymoma -1.800 2.0e-02
esophageal adenocarcinoma -1.300 4.1e-02
glioblastoma -2.300 1.9e-08
intraductal papillary-mucinous neoplasm ... 1.900 5.2e-04
invasive ductal carcinoma 2.200 9.1e-03
lung cancer 1.300 4.3e-02
malignant mesothelioma 3.100 3.8e-07
medulloblastoma -1.600 9.1e-03
medulloblastoma, large-cell -2.700 6.4e-03
nasopharyngeal carcinoma -2.300 7.1e-09
oligodendroglioma -2.000 1.0e-02
osteosarcoma -1.295 8.9e-05
pancreatic cancer 1.100 9.2e-04
psoriasis 1.200 6.0e-78
spina bifida -2.217 4.6e-02
ulcerative colitis 1.300 8.5e-05

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKD      1 - 70
KKFREAIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQ     71 - 140
AELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMK    141 - 210
LSRCSQREKEAM                                                              211 - 222
//

Text Mined References (9)

PMID Year Title