Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.47
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.600 2.6e-05
astrocytic glioma -2.500 1.2e-03
Astrocytoma, Pilocytic -1.500 1.1e-03
atypical teratoid / rhabdoid tumor -2.800 8.1e-05
colon cancer 1.900 5.4e-05
ductal carcinoma in situ 1.600 2.4e-02
ependymoma -1.800 2.0e-02
esophageal adenocarcinoma -1.300 4.1e-02
glioblastoma -2.300 1.9e-08
intraductal papillary-mucinous neoplasm ... 1.900 5.2e-04
invasive ductal carcinoma 2.200 9.1e-03
lung cancer 1.300 4.3e-02
malignant mesothelioma 3.100 3.8e-07
medulloblastoma -1.600 9.1e-03
medulloblastoma, large-cell -2.700 6.4e-03
nasopharyngeal carcinoma -2.300 7.1e-09
oligodendroglioma -2.000 1.0e-02
osteosarcoma -1.295 8.9e-05
pancreatic cancer 1.100 9.2e-04
psoriasis 1.200 6.0e-78
spina bifida -2.217 4.6e-02
ulcerative colitis 1.300 8.5e-05

Synonym

Accession Q92623 Q86WT2 TPR repeat protein 9A
Symbols TTC9A

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKD      1 - 70
KKFREAIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQ     71 - 140
AELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMK    141 - 210
LSRCSQREKEAM                                                              211 - 222
//

Text Mined References (9)

PMID Year Title