Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.57
PubTator Score 0.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.500 6.8e-03
chronic rhinosinusitis -1.701 8.5e-03
cystic fibrosis and chronic rhinosinusit... -1.221 4.5e-02
ependymoma 1.200 4.5e-03
lung carcinoma 1.700 1.0e-17
psoriasis -1.400 1.4e-10

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MMKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKA      1 - 70
KRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMTYKLAITDLTTAISMDKNSYT     71 - 140
AFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNG    141 - 210
SLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAY    211 - 280
IKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEF    281 - 350
LTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLM    351 - 420
NRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFR    421 - 490
AKVRGKIGLIEEAMADYNQALDLEDYASVI                                            491 - 520
//

Text Mined References (7)

PMID Year Title