Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.723 6.5e-03
aldosterone-producing adenoma -1.027 2.6e-02
astrocytic glioma -1.900 3.0e-02
atypical teratoid / rhabdoid tumor -1.100 4.5e-02
Breast cancer 2.300 3.0e-02
cystic fibrosis 1.090 7.4e-04
ependymoma -2.100 4.6e-02
gastric carcinoma 1.100 4.5e-02
glioblastoma 1.100 1.6e-05
intraductal papillary-mucinous adenoma (... 1.200 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.100 7.8e-03
non-small cell lung cancer 1.111 3.8e-11
osteosarcoma -1.888 4.4e-06
ovarian cancer -1.300 5.1e-04
pancreatic ductal adenocarcinoma liver m... -2.852 1.7e-03
pituitary cancer -1.400 1.2e-02

 Compartment GO Term (1)

AA Sequence

MAGSEQQRPRRRDDGDSDAAAAAAAPLQDAELALAGINMLLNNGFRESDQLFKQYRNHSPLMSFGASFVS      1 - 70
FLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQRQIIIADCQV     71 - 140
YLAVLSFVKQELSAYIKGGWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNHIVAEGVSEE    141 - 210
SLNRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHT    211 - 280
VVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSFHTALELAVDQRE    281 - 350
IQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKR    351 - 420
KNNQIEQFSVKKAERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQACHEVDDSSVVGLKYLL    421 - 490
LGAIHKCLGNSEDAVQYFQRAVKDELCRQNNLYVQPYACYELGCLLLDKPETVGRGRALLLQAKEDFSGY    491 - 560
DFENRLHVRIHAALASLRELVPQ                                                   561 - 583
//

Text Mined References (4)

PMID Year Title