Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.900 3.0e-02
ependymoma -2.100 4.6e-02
osteosarcoma -3.504 2.7e-06
glioblastoma 1.200 2.4e-05
cystic fibrosis 1.090 7.4e-04
atypical teratoid / rhabdoid tumor -1.100 4.5e-02
adrenocortical carcinoma -1.946 9.6e-04
pancreatic ductal adenocarcinoma liver m... -2.852 1.7e-03
non-small cell lung cancer 1.130 1.6e-12
intraductal papillary-mucinous adenoma (... 1.200 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.100 7.8e-03
Breast cancer 2.300 3.0e-02
aldosterone-producing adenoma -1.027 2.6e-02
gastric carcinoma 1.100 4.5e-02
ovarian cancer 2.000 1.4e-05
pituitary cancer -3.000 2.0e-04

AA Sequence

MAGSEQQRPRRRDDGDSDAAAAAAAPLQDAELALAGINMLLNNGFRESDQLFKQYRNHSPLMSFGASFVS      1 - 70
FLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQRQIIIADCQV     71 - 140
YLAVLSFVKQELSAYIKGGWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNHIVAEGVSEE    141 - 210
SLNRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHT    211 - 280
VVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSFHTALELAVDQRE    281 - 350
IQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKR    351 - 420
KNNQIEQFSVKKAERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQACHEVDDSSVVGLKYLL    421 - 490
LGAIHKCLGNSEDAVQYFQRAVKDELCRQNNLYVQPYACYELGCLLLDKPETVGRGRALLLQAKEDFSGY    491 - 560
DFENRLHVRIHAALASLRELVPQ                                                   561 - 583
//

Text Mined References (4)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.