Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.71
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 1.3e-02
ependymoma -1.700 3.2e-07
oligodendroglioma -1.400 4.9e-02
osteosarcoma -1.343 8.1e-04
glioblastoma -1.800 1.3e-04
medulloblastoma -2.500 8.0e-07
atypical teratoid / rhabdoid tumor -2.500 7.8e-07
medulloblastoma, large-cell -3.400 2.0e-06
primitive neuroectodermal tumor -1.500 1.6e-03
tuberculosis 1.600 5.9e-05
intraductal papillary-mucinous carcinoma... 1.700 4.6e-02
pediatric high grade glioma -1.300 2.8e-03

Pathway (1)

Protein-protein Interaction (2)

Gene RIF (6)

PMID Text
25920552 Two new polymorphisms associated with gall bladder disease and obesity in women have been identified, GCKR rs1260326, and TTC39B rs686030.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20686565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAVLACRLRGRGNRVAALRPRPRPGGSAGPSPFALLCAGLSPEPRAGVGSEFPAWFLGGSSQRRNMALL      1 - 70
GSRAELEADEDVFEDALETISISSHSDMATSSLHFASCDTQQAPRQRGASTVSSSSSTKVDLKSGLEECA     71 - 140
VALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQTCQKYRKKY    141 - 210
TVVESFSSLLSRGSLEQLSEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSI    211 - 280
LHEIQKNKLQQEFFYEFEGGVKLGSGAFNLMLSLLPARIIRLLEFIGFSGNRELGLLQLREGASGRSMRS    281 - 350
ALCCLTILAFHTYISLILGTGEVNVAEAERLLAPFLQQFPNGSLVLFYHARIELLKGNLEEAQEVFQKCI    351 - 420
SVQEEWKQFHHLCYWELMWINVFQQNWMQAYYYSDLLCKESKWSKATYVFLKAAILSMLPEEDVVATNEN    421 - 490
VVTLFRQVDSLKQRIAGKSIPTEKFAVRKARRYSASLPAPVKLILPALEMMYVWNGFSIVSKRKDLSENL    491 - 560
LVTVEKAEAALQSQNFNSFSVDDECLVKLLKGCCLKNLQRPLQAELCYNHVVESEKLLKYDHYLVPFTLF    561 - 630
ELASLYKSQGEIDKAIKFLETARNNYKDYSLESRLHFRIQAALHLWRKPSSD                      631 - 682
//

Text Mined References (17)

PMID Year Title
25920552 2016 Lipids, obesity and gallbladder disease in women: insights from genetic studies using the cardiovascular gene-centric 50K SNP array.
25416956 2014 A proteome-scale map of the human interactome network.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.