Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Celiac disease 116 0.0 1.6
Disease Target Count Z-score Confidence
Retinitis pigmentosa 3 16 3.849 1.9

Expression

 Compartment GO Term (0)

AA Sequence

MLQRSPRAGPSRAQGRREAAETGGPTTQEGVACGVHQLATLLMELDSEDEASRLLAADALYRLGRLEETH      1 - 70
KALLVALSRRPQAAPVLARLALLQLRRGFFYDANQLVKKLVQSGDTACLQPTLDVFCHEDRQLLQGHCHA     71 - 140
RALAILRARPGGADGRVHTKEAIAYLSLAIFAAGSQASESLLARARCYGFLGQKKTAMFDFNTVLRAEPG    141 - 210
NVQALCGRALVHLALDQLQEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRALLSQLPDTG    211 - 280
APLEDKDTQGLLAVGEALIKIDSGQPHWHLLLADILMAQGSYEEAGTHLEKALHRAPTSEAARARLGLLQ    281 - 350
LKKGDVPGAARDLQSLAEVDAPDLSCLLHLLEASERQSLAQAAAQEAGTLLDAGQPRQALGYCSLSVLAS    351 - 420
GSSACHLRLRATCLAELQEFGRALRDLDHVLQEALGDGDLPRRAEDFCRQGRLLLSLGDEAAAAGAFAQA    421 - 490
LKLAPSLAQNSLCRQPGRAPTARMFLLRGQCCLEEQRHAEAWTAVESGLLVDPDHRGLKRLKARIRREAS    491 - 560
SGCWLQ                                                                    561 - 566
//

Text Mined References (1)

PMID Year Title