Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.4e-08
ovarian cancer 8520 8.0e-06
hepatocellular carcinoma 547 2.7e-05
tuberculosis 2010 3.4e-04
lung cancer 4740 2.1e-03
gastric cancer 459 5.0e-03
sarcoidosis 370 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 5.0e-03
hepatocellular carcinoma 1.400 2.7e-05
lung cancer -1.200 2.1e-03
ovarian cancer -1.600 8.0e-06
psoriasis -1.100 5.4e-08
sarcoidosis 1.100 3.1e-02
tuberculosis -1.500 3.4e-04

AA Sequence

MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA      1 - 70
ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL     71 - 140
GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE    141 - 210
IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKAR                      211 - 262
//

Text Mined References (13)

PMID Year Title