Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.22
PubTator Score 64.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.354 2.9e-07
adrenocortical carcinoma -1.784 2.1e-03
astrocytic glioma -2.900 7.6e-04
Astrocytoma, Pilocytic -2.300 1.8e-04
atypical teratoid / rhabdoid tumor -2.000 3.6e-02
cystic fibrosis 3.174 3.6e-07
ductal carcinoma in situ 1.300 1.4e-02
glioblastoma -2.800 1.4e-03
group 3 medulloblastoma -3.300 8.4e-05
interstitial cystitis -1.600 1.3e-04
medulloblastoma, large-cell -4.300 2.7e-06
oligodendroglioma -1.600 1.7e-09
osteosarcoma -3.244 1.6e-04
ovarian cancer 1.200 2.7e-02
pediatric high grade glioma -2.200 1.2e-03
primitive neuroectodermal tumor -3.800 1.9e-05
tuberculosis 1.800 1.6e-08
ulcerative colitis -1.300 1.2e-07

Gene RIF (5)

AA Sequence

MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKL      1 - 70
EDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES                              71 - 115
//

Text Mined References (18)

PMID Year Title