Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.32
PubTator Score 12.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 1.309 4.6e-03
Atopic dermatitis 1.100 2.1e-03
Breast cancer 1.500 1.0e-15
breast carcinoma 1.200 2.6e-24
diabetes mellitus -1.200 5.1e-03
ductal carcinoma in situ 1.300 8.1e-03
intraductal papillary-mucinous adenoma (... 1.300 1.6e-04
invasive ductal carcinoma 1.200 1.5e-02
lung adenocarcinoma 1.200 2.1e-07
lung carcinoma 1.300 1.3e-17
non-small cell lung carcinoma 1.200 3.8e-23
osteosarcoma -1.020 3.7e-02
ovarian cancer 1.300 2.7e-04
pancreatic cancer 1.100 3.4e-05
psoriasis 2.700 7.0e-06

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA      1 - 70
AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN     71 - 140
FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT    141 - 210
GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF    211 - 280
KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK                                 281 - 321
//

Text Mined References (18)

PMID Year Title