Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.86
PubTator Score 2.90

Knowledge Summary

Patent (1,299)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 1.5e-08
osteosarcoma 7766 2.9e-07
Disease Target Count Z-score Confidence
Oligospermia 32 4.185 2.1
Azoospermia 106 3.021 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.085 2.9e-07
ovarian cancer 1.200 1.5e-08

Gene RIF (2)

AA Sequence

MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNI      1 - 70
IQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCENA     71 - 140
LLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF    141 - 210
DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAST                211 - 268
//

Text Mined References (8)

PMID Year Title