Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.99
PubTator Score 8.66

Knowledge Summary

Patent (2,038)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Male infertility 199 4.109 2.1
Infertility 176 3.561 1.8

Gene RIF (6)

AA Sequence

MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG      1 - 70
SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE     71 - 140
NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT    211 - 280
SSASFKREGEGKYRAECKLDTKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG    281 - 350
AEVGKAST                                                                  351 - 358
//

Text Mined References (17)

PMID Year Title