Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.60
PubTator Score 2.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.3e-06
ovarian cancer 8491 8.5e-06
invasive ductal carcinoma 2950 8.1e-04
lung cancer 4473 1.7e-03
psoriasis 6685 1.9e-03
Disease Target Count Z-score Confidence
adrenocortical carcinoma 1427 3.116 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.100 1.9e-03
atypical teratoid / rhabdoid tumor -1.100 4.3e-06
lung cancer 1.300 1.7e-03
invasive ductal carcinoma 1.100 8.1e-04
ovarian cancer 1.200 8.5e-06

Gene RIF (1)

PMID Text
23933319 TSSC1 inhibits breast cancer cell invasion. Subsequently, TSSC1 is confirmed as a target of Runx2 and is negatively regulated by Runx2.

AA Sequence

MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHI      1 - 70
SASPADRGVLTTCYNRTSDSKVLTCAAVWRMPKELESGSHESPDDSSSTAQTLELLCHLDNTAHGNMACV     71 - 140
VWEPMGDGKKIISLADNHILLWDLQESSSQAVLASSASLEGKGQLKFTSGRWSPHHNCTQVATANDTTLR    141 - 210
GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRY    211 - 280
NHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSV    281 - 350
YAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL                                     351 - 387
//

Text Mined References (12)

PMID Year Title
23933319 2013 Runx2 induces bone osteolysis by transcriptional suppression of TSSC1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9925925 1998 Subchromosomal assignment1 of the TSSC1 gene to human chromosome band 11p15.5 near the HBB gene cluster.
9403053 1997 A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.