Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.29
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.9e-08
osteosarcoma 7950 1.3e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.396 1.3e-05
ovarian cancer 2.200 8.9e-08

Gene RIF (1)

AA Sequence

MGRRRAARGPGAEGGRPRHLPTRSLEAFAEEVGAALQASVEPGAADGEGGPGPAALPCTLAMWELGHCDP      1 - 70
RRCTGRKLARLGLVRCLRLGHRFGGLVLSPVGKQYASPADRQLVAQSGVAVIDCSWARLDETPFGKMRGS     71 - 140
HLRLLPYLVAANPVNYGRPYRLSCVEAFAATFCIVGFPDLAVILLRKFKWGKGFLDLNRQLLDKYAACGS    141 - 210
PEEVLQAEQEFLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDPGPGAERGGAS    211 - 280
SSCCEEEQTQGRGAEARAPAEVWKGIKKRQRD                                          281 - 312
//

Text Mined References (8)

PMID Year Title