Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.89
PubTator Score 2.68

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 8.9e-08
osteosarcoma 7933 1.3e-05


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.396 1.3e-05
ovarian cancer 2.200 8.9e-08


Accession Q9UJK0 Q6PJT8
Symbols C16orf42


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

SSCCEEEQTQGRGAEARAPAEVWKGIKKRQRD                                          281 - 312

Text Mined References (8)

PMID Year Title
27084949 2016 Ribosome biogenesis factor Tsr3 is the aminocarboxypropyl transferase responsible for 18S rRNA hypermodification in yeast and humans.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.