Property Summary

NCBI Gene PubMed Count 8
PubMed Score 30.57
PubTator Score 11.21

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
Multiple myeloma -1.056 4.0e-02
astrocytic glioma 1.300 1.3e-02
ependymoma 1.500 1.0e-03
oligodendroglioma 1.400 6.7e-04
osteosarcoma 1.355 3.8e-05
medulloblastoma, large-cell 1.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... 1.722 2.3e-03
non-small cell lung cancer 1.151 1.8e-14
lung cancer 2.400 3.3e-03
Breast cancer 2.400 4.0e-02
group 3 medulloblastoma 1.700 2.5e-03
ovarian cancer 1.200 5.6e-04

Gene RIF (2)

20805244 hTsr1 is involved downstream in nuclear export of the pre-40S particles.
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

KRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME                                        771 - 804

Text Mined References (10)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20805244 2011 Analysis of two human pre-ribosomal factors, bystin and hTsr1, highlights differences in evolution of ribosome biogenesis between yeast and mammals.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.