Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.36
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.900 2.0e-03
astrocytic glioma -2.500 4.2e-03
Breast cancer -1.400 8.2e-03
chronic lymphosyte leukemia -1.400 3.7e-12
colon cancer -1.900 2.1e-02
ependymoma -1.200 4.6e-03
glioblastoma -1.100 3.8e-02
intraductal papillary-mucinous carcinoma... -1.500 2.5e-02
lung carcinoma 1.200 6.3e-15
malignant mesothelioma 8.600 2.3e-10
medulloblastoma, large-cell -1.900 3.6e-02
oligodendroglioma -2.100 2.6e-02
primitive neuroectodermal tumor -1.800 5.0e-02
psoriasis -1.700 1.8e-07
subependymal giant cell astrocytoma -1.205 2.9e-02
tuberculosis 1.600 4.6e-05
ulcerative colitis 1.100 1.7e-02

Gene RIF (8)

AA Sequence

MSGRSRGRKSSRAKNRGKGRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLEAAASAQL      1 - 70
LRLGEEAACRLPLDCGLALRARAAGDHGQAAARPGPGKAASLSERLAADTVFVGTAGTVGRPKNAPRVGN     71 - 140
RRGPAGKKAPETCSTAGRGPQVIAGGRQKKGAAGENTSVSAGEEKKEERDAGSGPPATEGSMDTLENVQL    141 - 210
KLENMNAQADRAYLRLSRKFGQLRLQHLERRNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSL    211 - 280
EVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSF    281 - 350
FGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARVEKGKEKEGRQGPGKQPMETTQPGVSQSN       351 - 417
//

Text Mined References (15)

PMID Year Title