Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.15
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 8.600 2.3e-10
astrocytic glioma -2.500 4.2e-03
oligodendroglioma -2.500 2.6e-15
psoriasis -1.800 1.3e-03
glioblastoma multiforme -2.100 8.2e-16
chronic lymphosyte leukemia -1.400 3.7e-12
posterior fossa group A ependymoma -1.500 4.4e-04
medulloblastoma, large-cell -1.900 3.6e-02
primitive neuroectodermal tumor -1.800 5.0e-02
tuberculosis and treatment for 3 months 1.800 3.9e-06
intraductal papillary-mucinous carcinoma... -1.500 2.5e-02
colon cancer -1.900 2.1e-02
adult high grade glioma -1.900 2.0e-03
subependymal giant cell astrocytoma -1.205 2.9e-02
lung carcinoma 1.200 6.3e-15
Breast cancer -1.400 8.2e-03
ulcerative colitis 1.100 1.7e-02

Synonym

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
26386860 Suggest that hypermethylation of ACP1, BMP4, and TSPYL5 are common events in HCC and could be used as potentially detectable biomarkers in HCC tissues.
23518928 TSPYL5 knockdown decreased, and overexpression increased aromatase (CYP19A1) expression through the skin/adipose (I.4) promoter.
21170034 Data identify TSPYL5 as a suppressor of p53 function through its interaction with USP7.
20079711 This study provides the first demonstration that TSPYL5 modulates cell growth and sensitization of cells to the detrimental effects of damaging agents via regulation of p21(WAF1/Cip1) and PTEN/AKT pathway.
18059362 aberrant methylation at a CpG island of TSPYL5 may play an important role in development of gastric cancers

AA Sequence

MSGRSRGRKSSRAKNRGKGRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLEAAASAQL      1 - 70
LRLGEEAACRLPLDCGLALRARAAGDHGQAAARPGPGKAASLSERLAADTVFVGTAGTVGRPKNAPRVGN     71 - 140
RRGPAGKKAPETCSTAGRGPQVIAGGRQKKGAAGENTSVSAGEEKKEERDAGSGPPATEGSMDTLENVQL    141 - 210
KLENMNAQADRAYLRLSRKFGQLRLQHLERRNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSL    211 - 280
EVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSF    281 - 350
FGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARVEKGKEKEGRQGPGKQPMETTQPGVSQSN       351 - 417
//

Text Mined References (12)

PMID Year Title
26386860 2016 Hypermethylation of ACP1, BMP4, and TSPYL5 in Hepatocellular Carcinoma and Their Potential Clinical Significance.
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
21269460 2011 Initial characterization of the human central proteome.
21170034 2011 TSPYL5 suppresses p53 levels and function by physical interaction with USP7.
20079711 2010 TSPYL5 is involved in cell growth and the resistance to radiation in A549 cells via the regulation of p21(WAF1/Cip1) and PTEN/AKT pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18059362 2008 Gene silencing of TSPYL5 mediated by aberrant promoter methylation in gastric cancers.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.