Property Summary

NCBI Gene PubMed Count 30
PubMed Score 31.50
PubTator Score 706.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.600 4.6e-05
ependymoma -1.700 5.8e-15
glioblastoma -1.200 2.9e-08
group 3 medulloblastoma -1.800 3.3e-05
medulloblastoma, large-cell -1.400 3.6e-06
tuberculosis -1.500 1.0e-06
non-small cell lung cancer -1.094 1.1e-18
pediatric high grade glioma -1.400 1.7e-08
atypical teratoid/rhabdoid tumor -1.200 1.1e-05
subependymal giant cell astrocytoma -1.409 5.2e-03
lung carcinoma 1.700 1.3e-24
Pick disease -1.200 3.6e-04
Breast cancer -1.200 4.2e-05

 GO Function (1)

Gene RIF (15)

PMID Text
26529358 homozygous Asp3779Asn and a hemizygous Ile262Met mutations in the LRP2 and TSPYL2 genes, respectively, in a Pakistani family with two boys affected with mild nonsyndromic intellectual disability
26089539 Authors demonstrate that human coilin-interacting nuclear ATPase protein (hCINAP) is a novel negative regulator in NF-kappaB signaling by deactivating IkappaB kinase (IKK) complex.
26059843 the extent of the duplicated regions in each case encompassing a minimum of three known disease genes TSPYL2, KDM5C and IQSEC2, is reported.
25613376 TSPYL2 is an essential component of the REST/NRSF transcriptional complex for TGFbeta signaling activation
25142742 Atrial fibrillation can result in alterations in atrial structure and architecture that make the atrial myocardium more susceptible to the maintenance of the arrhythmia.
25017435 The oncogenic events leading to an ectopic activation of TSPY and/or inactivating mutation/epigenetic silencing of TSPX could collectively contribute to the sexual dimorphism(s) in HCC and related liver cancers in male-biased manners.
23246961 More importantly, RPS14 was specifically modified with NEDD8 and hCINAP inhibited RPS14 NEDDylation by recruiting NEDD8-specific protease 1
22038794 hCINAP may not simply regulate nucleotide homeostasis, but may have broader functionality, including control of Cajal body assembly and disassembly
21204751 TSPX is principally expressed in Sertoli cells in the human testis.
20186459 knockdown of CINAP expression results in marked reduction of histone transcription, lower levels of U small nuclear RNAs (U1, U2, U4, and U5), and a loss of cell viability
18381359 a role for DENTT as a suppressor of the tumorigenic phenotype.
17317670 CDA1 induces p53- and MEK/ERK1/2 MAPK-dependent expression of p21 by acting through the p53 responsive element in the p21 promoter and this contributes to its antiproliferative activity
17069459 Overexpression of cell division autoantigen-1 (CDA1) slowed parasite growth and induced expression of bradyzoite-specific proteins. Results showed that changes in host cell transcription can influence the molecular environment for bradyzoite development.
16079131 hCINAP is a novel coilin-interacting protein encoded by a transcript from the transcription factor TAFIID32 locus
15823505 This paper characterizes monkey DENTT cDNA and makes a comparison with human and mouse DENTT

AA Sequence

MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLADMRGVGLGPAL      1 - 70
PPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPTPEASGGSLEIDFQVVQSSSF     71 - 140
GGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDERESMRSSRRRRRRRRRKQRKVKRESRERNAE    141 - 210
RMESILQALEDIQLDLEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILI    211 - 280
NRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEP    281 - 350
QARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE    351 - 420
VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNN    421 - 490
ETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSD    491 - 560
SDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDE    561 - 630
SVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG           631 - 693
//

Text Mined References (39)

PMID Year Title
26529358 2016 Identification of a homozygous missense mutation in LRP2 and a hemizygous missense mutation in TSPYL2 in a family with mild intellectual disability.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26089539 2015 hCINAP negatively regulates NF-?B signaling by recruiting the phosphatase PP1 to deactivate IKK complex.
26059843 2016 Xp11.2 microduplications including IQSEC2, TSPYL2 and KDM5C genes in patients with neurodevelopmental disorders.
25613376 2015 TSPYL2 is an essential component of the REST/NRSF transcriptional complex for TGF? signaling activation.
25142742 2014 Sinus rhythm restoration affects collagen turnover in patients with persistent atrial fibrillation.
25017435 2014 The potential contributions of a Y-located protooncogene and its X homologue in sexual dimorphisms in hepatocellular carcinoma.
23929772 2013 Genetic deletion of cell division autoantigen 1 retards diabetes-associated renal injury.
23246961 2014 hCINAP is a novel regulator of ribosomal protein-HDM2-p53 pathway by controlling NEDDylation of ribosomal protein S14.
22038794 2012 hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: structural and functional studies.
21204751 2011 Role of the Y-located putative gonadoblastoma gene in human spermatogenesis.
20186459 2010 Depletion of hCINAP by RNA interference causes defects in Cajal body formation, histone transcription, and cell viability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18649364 2008 The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein.
18381359 2008 Differentially expressed nucleolar transforming growth factor-beta1 target (DENTT) exhibits an inhibitory role on tumorigenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17317670 2007 Antiproliferative autoantigen CDA1 transcriptionally up-regulates p21(Waf1/Cip1) by activating p53 and MEK/ERK1/2 MAPK pathways.
17069459 2006 Changes in the expression of human cell division autoantigen-1 influence Toxoplasma gondii growth and development.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15823505 2005 Differentially expressed nucleolar TGF-beta1 target (DENTT) shows tissue-specific nuclear and cytoplasmic localization and increases TGF-beta1-responsive transcription in primates.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15241014 2004 TSPY, the candidate gonadoblastoma gene on the human Y chromosome, has a widely expressed homologue on the X - implications for Y chromosome evolution.
15069065 2004 A constitutively active arylhydrocarbon receptor induces growth inhibition of jurkat T cells through changes in the expression of genes related to apoptosis and cell cycle arrest.
15066269 2004 Transcriptional modification by a CASK-interacting nucleosome assembly protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393179 2002 Isolation of differentially expressed genes in human heart tissues.
11395479 2001 SET-related cell division autoantigen-1 (CDA1) arrests cell growth.
11318608 2001 Identification of differentially expressed nucleolar TGF-beta1 target (DENTT) in human lung cancer cells that is a new member of the TSPY/SET/NAP-1 superfamily.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.