Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.75
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.237 5.2e-03
astrocytic glioma -2.700 7.5e-03
ependymoma -2.700 1.6e-02
oligodendroglioma -2.400 2.1e-02
glioblastoma -3.700 3.4e-10
osteosarcoma -1.125 4.4e-04
medulloblastoma -3.400 8.2e-11
atypical teratoid / rhabdoid tumor -3.900 3.6e-16
medulloblastoma, large-cell -3.900 6.6e-08
primitive neuroectodermal tumor -3.100 4.6e-07
intraductal papillary-mucinous carcinoma... -1.100 5.0e-02
Breast cancer 2.900 2.7e-02
adult high grade glioma -2.900 1.7e-05
pilocytic astrocytoma -2.400 2.6e-07
subependymal giant cell astrocytoma -2.545 4.6e-03
Pick disease -1.300 4.1e-02
ovarian cancer -2.600 6.8e-10

Synonym

Accession Q9H0U9 O75885 Q5TFE6 TSPY-like protein 1
Symbols TSPYL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
25449952 Results show that mutations and polymorphisms in the TSPYL1 gene were not associated with sudden infant death syndrome in a cohort of 165 deceased Swiss infants.
24412650 HIV-1 Vpr interacts with TSPYL1 and C20orf94 subunits of the SLX4 complex in Vpr-expressing THP-1 cells
22137496 Mutations in the TSPYL1 gene do not seem to play a major role in the pathogenesis of idiopathic male infertility, and mutation screening of the TSPYL1 gene can currently not be recommended in routine diagnostics of idiopathic male infertility.
19463995 Mutations in TSPYL1 may contribute to anomalies of testicular development/function.
16952470 The chromatin remodeling factor TSPYL1 had a very similar pattern of expression with an incremental increase in HPFH and decreased expression in deltabeta-thalassemia.
16418600 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGV      1 - 70
PQDAAGRGGTPQIRVVGGRGHVAIKAGQEEGQPPAEGLAAASVVMAADRSLKKGVQGGEKALEICGAQRS     71 - 140
ASELTAGAEAEAEEVKTGKCATVSAAVAERESAEVVKEGLAEKEVMEEQMEVEEQPPEGEEIEVAEEDRL    141 - 210
EEEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWM    211 - 280
TAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVS    281 - 350
LSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLREGVRRARRR    351 - 420
PLREPVEIPRPFGFQSG                                                         421 - 437
//

Text Mined References (18)

PMID Year Title
25449952 2015 Variants in TSPYL1 are not associated with sudden infant death syndrome in a cohort of deceased infants from Switzerland.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22137496 2012 Should TSPYL1 mutation screening be included in routine diagnostics of male idiopathic infertility?
21269460 2011 Initial characterization of the human central proteome.
19463995 2009 Mutations in the TSPYL1 gene associated with 46,XY disorder of sex development and male infertility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16952470 Identification of novel candidate genes for globin regulation in erythroid cells containing large deletions of the human beta-globin gene cluster.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16418600 2006 Genetic investigation of the TSPYL1 gene in sudden infant death syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273283 2004 Mapping of sudden infant death with dysgenesis of the testes syndrome (SIDDT) by a SNP genome scan and identification of TSPYL loss of function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9730615 1998 Murine and human TSPYL genes: novel members of the TSPY-SET-NAP1L1 family.