Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.14
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.8e-09
osteosarcoma 7933 7.3e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.176 7.3e-06
ovarian cancer 1.100 1.8e-09

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19729679 identify the TSPO2 family of proteins as mediators of cholesterol redistribution-dependent erythroblast maturation during mammalian erythropoiesis
19625176 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYASYLVWKDLGG      1 - 70
GLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKLAALLLLPYLA     71 - 140
WLTVTSALTYHLWRDSLCPVHQPQPTEKSD                                            141 - 170
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19729679 2009 Translocator protein 2 is involved in cholesterol redistribution during erythropoiesis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.