Property Summary

Ligand Count 1
NCBI Gene PubMed Count 125
PubMed Score 2284.19
PubTator Score 966.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.400 1.4e-03
astrocytoma 1.100 5.2e-03
Astrocytoma, Pilocytic 1.800 6.6e-08
atypical teratoid / rhabdoid tumor 1.200 1.1e-03
ependymoma 1.500 4.5e-07
glioblastoma 1.700 4.4e-08
group 4 medulloblastoma -1.100 1.4e-03
intraductal papillary-mucinous adenoma (... 1.400 2.0e-04
malignant mesothelioma -2.800 3.6e-08
osteosarcoma -1.149 4.8e-03
ovarian cancer -1.100 3.6e-03
pancreatic cancer 1.100 2.4e-05
psoriasis 1.400 2.1e-04
subependymal giant cell astrocytoma 1.402 2.8e-02
tuberculosis 1.800 1.8e-08
Waldenstrons macroglobulinemia 1.109 2.9e-02

Gene RIF (108)

AA Sequence

MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLRMAGQPWLAWG      1 - 70
TAAARVSARPTRDCSCTSRCHHACDVVAVTLS                                           71 - 102
//

Text Mined References (125)

PMID Year Title