Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.55
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1670 7.4e-05
psoriasis 6685 2.0e-04
group 4 medulloblastoma 1875 2.7e-03
medulloblastoma, large-cell 6234 1.2e-02
Disease Target Count Z-score Confidence
Fallopian tube carcinoma 2 4.825 2.4
Apraxia 25 3.203 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 2.0e-04
cystic fibrosis -1.193 7.4e-05
medulloblastoma, large-cell 1.500 1.2e-02
group 4 medulloblastoma 1.400 2.7e-03

Gene RIF (6)

PMID Text
26865714 TSPAN9 is an endosomal tetraspanin whose depletion has a pronounced effect on the entry of several viruses that fuse in the early endosome.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18799160 tetraspanin CD9 has a role in determining vascular smooth muscle cell injury phenotypes
18795891 Findings suggest a role for Tspan9 in regulating platelet function in concert with other platelet tetraspanins and their associated proteins.

AA Sequence

MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFL      1 - 70
GCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNI     71 - 140
IQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGM    141 - 210
CILIMQILGMAFSMTLFQHIHRTGKKYDA                                             211 - 239
//

Text Mined References (17)

PMID Year Title
26865714 2016 Role of TSPAN9 in Alphavirus Entry and Early Endosomes.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23746317 2014 Genome-wide association study of degenerative bony changes of the temporomandibular joint.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18799160 2009 Functional relevance of tetraspanin CD9 in vascular smooth muscle cell injury phenotypes: a novel target for the prevention of neointimal hyperplasia.
18795891 2009 Identification of Tspan9 as a novel platelet tetraspanin and the collagen receptor GPVI as a component of tetraspanin microdomains.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10719184 2000 Sequence and expression of seven new tetraspans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.