Property Summary

NCBI Gene PubMed Count 52
PubMed Score 48.84
PubTator Score 35.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (41)

PMID Text
26649804 This novel nuclear localization of TM4SF3 depends on androgen-induced nuclear localization of androgen receptor (AR) in both androgen-dependent and androgen-independent prostate cancer cell lines
26562525 Our data suggest that TSPAN8-LEL may play an important role in mCRC cell invasion, and that the antibody we have developed could be a useful tool for inhibiting the invasion of TSPAN8-expressing mCRCs.
25680464 Tspn8 was over-expressed in multiple clinical malignant glioma tissues, and its expression level correlated with the grade of tumors.
25261323 Based on nasopharyngeal TSPAN8 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
22679508 CO-029 functions as a regulator of both cell-matrix and cell-cell adhesion. During colon cancer progression, CO-029 promotes cancer cell movement by deregulating cell adhesions.
21081927 High TSPAN8 is associated with melanoma invasiveness.
20937409 PMA-induced Tspan8-internalization promotes cell migration, but reduces matrix and cell adhesion.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360734 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20052686 Observational study of gene-disease association. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19862325 Observational study of gene-disease association. (HuGE Navigator)
19833889 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19670153 Observational study of gene-disease association. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247373 Observational study of gene-disease association. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18714373 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18567820 Observational study of gene-disease association. (HuGE Navigator)
18372903 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18365756 overexpression of TM4SF3 in esophageal cancer conferred advantage to the invasion and metastasis of this destructive disease
18317468 Genome-wide association study of gene-disease association. (HuGE Navigator)
17579117 claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILG      1 - 70
FLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQE     71 - 140
AIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVI    141 - 210
GISFGLAVIEILGLVFSMVLYCQIGNK                                               211 - 237
//

Text Mined References (54)

PMID Year Title
26649804 2016 TM4SF3 and AR: A Nuclear Complex that Stabilizes Both Proteins.
26562525 2015 Generation of a human antibody that inhibits TSPAN8-mediated invasion of metastatic colorectal cancer cells.
25680464 2015 Over-expression of tetraspanin 8 in malignant glioma regulates tumor cell progression.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22679508 2012 Tetraspanin CO-029 inhibits colorectal cancer cell movement by deregulating cell-matrix and cell-cell adhesions.
21081927 2011 Gene expression profiles of human melanoma cells with different invasive potential reveal TSPAN8 as a novel mediator of invasion.
20937409 2011 Activation-induced internalization differs for the tetraspanins CD9 and Tspan8: Impact on tumor cell motility.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360734 2010 Genome-wide association study of CNVs in 16,000 cases of eight common diseases and 3,000 shared controls.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20052686 2010 Functional variants of TSPAN8 are associated with bipolar disorder and schizophrenia.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19862325 2009 PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 are associated with type 2 diabetes in a Chinese population.
19833889 2010 Genetic heterogeneity in latent autoimmune diabetes is linked to various degrees of autoimmune activity: results from the Nord-Trøndelag Health Study.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19247373 2009 Testing the association of novel meta-analysis-derived diabetes risk genes with type II diabetes and related metabolic traits in Asian Indian Sikhs.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18714373 2008 Novel meta-analysis-derived type 2 diabetes risk loci do not determine prediabetic phenotypes.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18567820 2008 Association testing of novel type 2 diabetes risk alleles in the JAZF1, CDC123/CAMK1D, TSPAN8, THADA, ADAMTS9, and NOTCH2 loci with insulin release, insulin sensitivity, and obesity in a population-based sample of 4,516 glucose-tolerant middle-aged Danes.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18365756 2008 TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
18317468 2008 Whole-genome association study of bipolar disorder.
17579117 2007 A complex of EpCAM, claudin-7, CD44 variant isoforms, and tetraspanins promotes colorectal cancer progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939584 2003 Novel differential gene expression in human cirrhosis detected by suppression subtractive hybridization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11690710 2001 Overexpression of tetraspanin CO-029 in hepatocellular carcinoma.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
8661157 1996 Genetic localization of Cd63, a member of the transmembrane 4 superfamily, reveals two distinct loci in the mouse genome.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2395876 1990 Molecular cloning of cDNA for the human tumor-associated antigen CO-029 and identification of related transmembrane antigens.