Property Summary

NCBI Gene PubMed Count 26
PubMed Score 76.04
PubTator Score 27.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.500 1.8e-07
glioblastoma -2.500 5.4e-03
posterior fossa group A ependymoma -1.300 2.0e-06
group 3 medulloblastoma -1.900 5.0e-04
atypical teratoid / rhabdoid tumor -3.200 4.3e-07
medulloblastoma, large-cell -2.300 6.6e-08
pancreatic ductal adenocarcinoma liver m... -1.311 6.6e-04
non-small cell lung cancer -2.004 2.8e-11
intraductal papillary-mucinous adenoma (... -2.800 3.4e-06
intraductal papillary-mucinous carcinoma... -2.500 3.9e-05
intraductal papillary-mucinous neoplasm ... -2.300 1.5e-03
colon cancer -2.700 5.6e-04
lung cancer -4.400 5.8e-07
active Crohn's disease -1.410 2.5e-02
ulcerative colitis -2.200 8.2e-07
pancreatic cancer -1.200 7.2e-04
pediatric high grade glioma -1.200 1.5e-03
primary Sjogren syndrome 1.600 1.2e-04
subependymal giant cell astrocytoma -1.359 1.7e-02
lung adenocarcinoma -1.859 2.3e-04
breast carcinoma -1.300 9.0e-18
Pick disease -1.300 7.8e-03
Breast cancer -1.100 5.5e-07
ductal carcinoma in situ -1.400 1.8e-03
invasive ductal carcinoma -3.100 4.3e-04
ovarian cancer -2.600 2.9e-05

Gene RIF (15)

PMID Text
25637218 Elevated TSPAN7 may be associated with better outcomes for multiple myeloma patients.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
23284715 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
22445342 This study identified that TSPAN7 as a key molecule for the functional maturation of dendritic spines via PICK1 and ampa receptor trafficking.
22213152 Loss of TSPAN7 is associated with metastasis in clear-cell renal cell carcinoma.
20951001 TM4SF2 was identified as a putative antigenic target in Wegener's granulomatosis
20850477 Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system.
20630051 The interaction of VP26 with tetraspanin-7 plays an essential role in normal HSV-1 replication.
20479760 Observational study of gene-disease association. (HuGE Navigator)
19894777 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19535787 associated with spermatozoa
19339915 coding mutations in TSPAN7 are not associated with our cohort of autism patients
17989173 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
14735593 The role of TMSF2 in mental retardation

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIV      1 - 70
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRA     71 - 140
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME    141 - 210
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV                                   211 - 249
//

Text Mined References (27)

PMID Year Title
25637218 2015 Tetraspanin 7 (TSPAN7) expression is upregulated in multiple myeloma patients and inhibits myeloma tumour development in vivo.
22445342 2012 The X-linked intellectual disability protein TSPAN7 regulates excitatory synapse development and AMPAR trafficking.
22213152 2012 CD31, EDNRB and TSPAN7 are promising prognostic markers in clear-cell renal cell carcinoma revealed by genome-wide expression analyses of primary tumors and metastases.
20951001 2011 Wegener's granuloma harbors B lymphocytes with specificities against a proinflammatory transmembrane protein and a tetraspanin.
20850477 2010 TL and CD8??: Enigmatic partners in mucosal immunity.
20630051 2010 Egress of HSV-1 capsid requires the interaction of VP26 and a cellular tetraspanin membrane protein.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
19339915 2009 Copy number variation analysis and sequencing of the X-linked mental retardation gene TSPAN7/TM4SF2 in patients with autism spectrum disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14735593 2004 Does the P172H mutation at the TM4SF2 gene cause X-linked mental retardation?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12777533 2003 Gene diversity patterns at 10 X-chromosomal loci in humans and chimpanzees.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070254 2002 A novel 2 bp deletion in the TM4SF2 gene is associated with MRX58.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11387256 2001 Involvement of alpha3 integrin/tetraspanin complexes in the angiogenic response induced by angiotensin II.
11161835 2001 Genes responsible for nonspecific mental retardation.
10655063 2000 A new gene involved in X-linked mental retardation identified by analysis of an X;2 balanced translocation.
10617319 1999 Molecular cloning of a cDNA encoding mouse A15, a member of the transmembrane 4 superfamily, and its preferential expression in brain neurons.
10449641 1999 Nonsyndromic X-linked mental retardation: mapping of MRX58 to the pericentromeric region.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
8420826 1993 Isolation of a novel cDNA clone showing marked similarity to ME491/CD63 superfamily.
8325628 1993 Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms.
8168850 1994 Chromosomal localization of three human genes coding for A15, L6, and S5.7 (TAPA1): all members of the transmembrane 4 superfamily of proteins.
7768645 1995 Identification of a highly specific surface marker of T-cell acute lymphoblastic leukemia and neuroblastoma as a new member of the transmembrane 4 superfamily.