Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.30
PubTator Score 4.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -5.400 5.0e-08
astrocytoma 2.600 2.5e-05
posterior fossa group B ependymoma 4.300 2.1e-23
oligodendroglioma 2.200 1.3e-02
glioblastoma 2.500 2.8e-12
osteosarcoma 2.297 9.3e-04
sonic hedgehog group medulloblastoma 2.500 4.4e-08
atypical teratoid/rhabdoid tumor 3.100 4.1e-13
primitive neuroectodermal tumor 2.200 1.4e-05
ulcerative colitis -1.300 5.1e-04
pancreatic ductal adenocarcinoma liver m... -2.545 5.5e-04
non-small cell lung cancer 1.832 2.7e-21
colon cancer 2.600 1.8e-02
lung cancer 2.100 1.8e-03
Breast cancer 2.400 2.5e-02
interstitial cystitis -2.300 4.8e-06
pediatric high grade glioma 2.800 5.1e-10
pilocytic astrocytoma 2.500 4.5e-12
subependymal giant cell astrocytoma 2.299 4.1e-02
nasopharyngeal carcinoma -1.200 4.9e-04
lung adenocarcinoma 1.810 1.5e-07
lung carcinoma -2.000 6.3e-16
spina bifida -2.130 4.6e-02
mucosa-associated lymphoid tissue lympho... 1.532 3.3e-02
ovarian cancer 1.400 3.2e-02
Down syndrome 1.100 5.0e-03

Gene RIF (1)

PMID Text
22908223 TSPAN6 functions as a negative regulator of the RLR pathway by interacting with MAVS in a ubiquitination-dependent manner.

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTV      1 - 70
IILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYR     71 - 140
SHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMG    141 - 210
VVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV                                       211 - 245
//

Text Mined References (21)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22091964 2012 Identification of genomic deletions spanning the PCDH19 gene in two unrelated girls with intellectual disability and seizures.
21269460 2011 Initial characterization of the human central proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314869 2005 Tetraspanin functions and associated microdomains.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12681443 2003 Tetraspanin proteins as organisers of membrane microdomains and signalling complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
9782095 1998 Cloning and characterization of a novel human gene, TM4SF6, encoding a protein belonging to the transmembrane 4 superfamily, and mapped to Xq22.
9714763 1998 Sequences and expression of six new members of the tetraspanin/TM4SF family.
9194523 1997 The tetraspanin superfamily: molecular facilitators.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.