Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.12
PubTator Score 4.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.600 2.2e-05
astrocytic glioma 2.300 6.1e-03
Astrocytoma, Pilocytic 1.900 2.9e-10
atypical teratoid / rhabdoid tumor 2.000 1.7e-08
Breast cancer 2.400 2.5e-02
colon cancer 2.600 1.8e-02
Down syndrome 1.100 5.0e-03
ependymoma 3.100 1.1e-02
glioblastoma 1.800 5.5e-10
group 3 medulloblastoma 1.600 1.1e-03
interstitial cystitis -1.800 6.9e-04
lung adenocarcinoma 1.307 2.7e-05
lung cancer 2.100 1.8e-03
lung carcinoma -2.000 6.3e-16
malignant mesothelioma -5.300 1.5e-09
mucosa-associated lymphoid tissue lympho... 1.532 3.3e-02
nasopharyngeal carcinoma -1.200 4.9e-04
non-small cell lung cancer 1.480 1.3e-17
oligodendroglioma 2.200 1.3e-02
osteosarcoma 2.297 9.3e-04
ovarian cancer -1.100 4.7e-03
pancreatic ductal adenocarcinoma liver m... -1.962 1.2e-03
primitive neuroectodermal tumor 1.800 7.2e-05
spina bifida -2.130 4.6e-02
subependymal giant cell astrocytoma 2.276 7.5e-03
ulcerative colitis -1.155 3.1e-02

Synonym

Accession O43657 Q54A42 Q6IAN9 Tspan-6
Symbols T245
TM4SF6
TSPAN-6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTV      1 - 70
IILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYR     71 - 140
SHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMG    141 - 210
VVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV                                       211 - 245
//

Text Mined References (22)

PMID Year Title