Property Summary

NCBI Gene PubMed Count 10
PubMed Score 262.21
PubTator Score 1490.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
24211713 TSPAN33 is overexpressed in activated and malignant B cells.

AA Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIV      1 - 70
VGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDD     71 - 140
LDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAF    141 - 210
DYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRAD    211 - 280
PWY                                                                       281 - 283
//

Text Mined References (11)

PMID Year Title
26686862 2016 TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.
24211713 2013 TSPAN33 is a novel marker of activated and malignant B cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23091066 2012 TspanC8 tetraspanins regulate ADAM10/Kuzbanian trafficking and promote Notch activation in flies and mammals.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158226 2007 Penumbra encodes a novel tetraspanin that is highly expressed in erythroid progenitors and promotes effective erythropoiesis.
16242907 2005 The phylogenetic analysis of tetraspanins projects the evolution of cell-cell interactions from unicellular to multicellular organisms.
16213355 2005 The human Penumbra gene is mapped to a region on chromosome 7 frequently deleted in myeloid malignancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.