Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.46
PubTator Score 105.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.4e-03
Breast cancer -1.300 3.2e-05
colon cancer -3.000 5.5e-09
cystic fibrosis -1.349 4.2e-03
ependymoma 1.800 3.7e-06
intraductal papillary-mucinous adenoma (... -1.500 2.6e-02
intraductal papillary-mucinous carcinoma... -1.700 1.5e-02
malignant mesothelioma 4.200 2.4e-08
non-small cell lung cancer -1.072 4.4e-07
osteosarcoma -1.981 5.0e-04
pituitary cancer 1.300 2.0e-02
tuberculosis 1.200 1.5e-03

Gene RIF (8)

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMM      1 - 70
AVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNG     71 - 140
TLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGLTIFGMIFSMVL    141 - 210
CCAIRNSRDVI                                                               211 - 221
//

Text Mined References (18)

PMID Year Title