Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.84
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.277 6.7e-04
chronic lymphocytic leukemia -3.807 1.2e-04
Multiple myeloma 1.383 1.0e-02
malignant mesothelioma -4.300 1.9e-09
astrocytic glioma -1.800 6.1e-03
ependymoma -2.500 1.6e-02
esophageal adenocarcinoma 1.600 2.5e-02
cystic fibrosis 2.456 2.0e-06
atypical teratoid / rhabdoid tumor -1.500 5.9e-03
glioblastoma -1.100 3.8e-03
Duchenne muscular dystrophy 1.149 3.0e-07
juvenile dermatomyositis 1.178 3.8e-08
tuberculosis and treatment for 3 months 1.400 1.5e-03
non-small cell lung cancer -1.054 3.0e-12
lung cancer -1.100 2.0e-04
lung adenocarcinoma -1.200 1.1e-10
Pick disease -1.400 2.4e-02
ductal carcinoma in situ 1.300 3.5e-03
invasive ductal carcinoma 2.000 4.4e-04
ovarian cancer -2.100 2.0e-06

Gene RIF (7)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26713053 The TSPAN13-to-S100A9 ratio was selected to determine the diagnostic value of urinary nucleic acids in prostate cancer (PCa) (P = 0.037) and shown to be significantly higher in PCa than in benign prostatic hyperplasia.
25505242 The interaction of HIV-1 CA with human cellular tetraspanin 13 protein (TSPAN13) is identified by yeast two-hybrid screen
19148481 TSPAN13 is overexpressed in prostate cancer and its expression correlates with factors of favourable outcome.
19148481 tspan13 is overexpressed in prostate cancer and its expression correlates with factors of favourable outcome
17486367 NET-6 is a potent new breast cancer suppressor gene.
15958618 NET-6 may represent a novel breast cancer suppressor gene.

AA Sequence

MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKH      1 - 70
HQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTC     71 - 140
LASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL          141 - 204
//

Text Mined References (17)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26713053 2015 Urinary Nucleic Acid TSPAN13-to-S100A9 Ratio as a Diagnostic Marker in Prostate Cancer.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
19148481 2009 Gene expression profiling reveals overexpression of TSPAN13 in prostate cancer.
17486367 2007 The tetraspanin superfamily member NET-6 is a new tumor suppressor gene.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15958618 2005 Aberrant expression of novel and previously described cell membrane markers in human breast cancer cell lines and tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10719184 2000 Sequence and expression of seven new tetraspans.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
27075 1978 Effects of sodium nitroprusside and other smooth muscle relaxants on cyclic GMP formation in smooth muscle and platelets.