Property Summary

NCBI Gene PubMed Count 28
PubMed Score 40.82
PubTator Score 29.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis -1.518 9.4e-03
urothelial carcinoma -2.300 2.5e-02
Barrett's esophagus 2.500 4.5e-02
esophageal adenocarcinoma 1.800 2.1e-02
osteosarcoma 1.071 1.7e-04
primary pancreatic ductal adenocarcinoma 1.862 3.6e-02
intraductal papillary-mucinous adenoma (... 3.200 1.3e-04
intraductal papillary-mucinous carcinoma... 2.800 4.2e-04
intraductal papillary-mucinous neoplasm ... 2.800 4.0e-03
colon cancer -2.400 1.0e-02
pancreatic cancer 2.700 2.4e-07
breast carcinoma 1.100 1.1e-02
fibroadenoma 1.800 3.7e-03
interstitial cystitis -1.800 8.0e-03
nasopharyngeal carcinoma -3.000 1.6e-07
Breast cancer 1.400 8.9e-04
invasive ductal carcinoma 1.700 2.6e-02
ovarian cancer 1.500 2.0e-04
pituitary cancer 1.400 4.7e-03
psoriasis -1.200 1.7e-41

Gene RIF (17)

PMID Text
26370588 The present study demonstrated that Tspan1 plays an important role in Pancreatic cancer carcinogenic progression, including migration and invasion.
26054975 Restoration of TSPAN1 rescued the effects of miR-573 overexpression. Therefore, our findings suggest that the miR-573/TSPAN1 axis is important in the control of gastric carcinogenesis
25301729 our current data demonstrate that miR-638 functions as a tumor suppressor in human colorectal carcinoma by inhibiting TSPAN1
23938385 TSPAN1 was proved to induce migration, and so up-regulation of TSPAN1 by miR-200a may explain why over-expressing miR-200a promotes NSCLC cells migration
23754316 these data argue against a role for tetraspanin 1 as a genuine mediator of cell surface receptor signalling but rather document a role for tetraspanin 1 in the control of cervical cancer cell motility and invasion.
22378020 data suggest that the NET-1 gene may play an important role in proliferation, migration and endocytosis in the development and progress of hepatocellular carcinoma
22088470 Study provided the gene expression profile of HBV-related HCC and presented differential expression patterns of SATB-1, TM4SF-1 and ST-14 between cancerous and noncancerous tissues in patients with HBV-related HCC.
21836059 These studies demonstrate for the first time that Tspan-1 is an interacting partner with human thiamine transporter-1 and that this interaction affects thiamine transporter-1 stability.
21302622 RNAi-mediated downregulation of TSPAN1 expression significantly inhibits the proliferation and invasion of colon cancer cells in vitro.
20890423 The overexpression of Tspan-1 was found in HCC tissues, positively correlated with clinical stage and negatively correlated with survival rate.
20680643 TSPAN1 may be another important breast cancer suppressor gene belonging to the tetraspanin superfamily.
19508227 Data show that Tspan-1-EGFP expressed in ovarian carcinoma cells was detected mainly in lysosomes, but also in the plasma membrane and in the ER.
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19017553 describe the generation of Tspan-1-specific antibodies and immunohistochemical staining of different subtypes of ovarian carcinomas that revealed significant differences in Tspan-1 expression that was pronounced in mucinous and endometrioid tumors
18822690 Overexpression of TSPAN1 and Ki67 was negatively correlated with carcinoma differentiation, and the overexpression of TSPAN1 and CD34 was positively correlated with infiltration and lymph node status of the tumor.
17913940 Detection of NET-1 gene expression in liver biopsy may provide useful information about the biological behavior of hepatocellular carcinoma.
12115476 Overexpression of NET-1 is associated with undifferentiated squamous cell carcinoma of cervical neoplasms

AA Sequence

MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFAL      1 - 70
GFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVW     71 - 140
NTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRT    141 - 210
NAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ                                           211 - 241
//

Text Mined References (30)

PMID Year Title
26370588 2015 Tetraspanin 1 is involved in survival, proliferation and carcinogenesis of pancreatic cancer.
26054975 2015 TSPAN1 functions as an oncogene in gastric cancer and is downregulated by miR-573.
25301729 2014 MicroRNA-638 inhibits cell proliferation, invasion and regulates cell cycle by targeting tetraspanin 1 in human colorectal carcinoma.
23938385 2013 MiR-200a enhances the migrations of A549 and SK-MES-1 cells by regulating the expression of TSPAN1.
23754316 2013 Tetraspanin 1 promotes invasiveness of cervical cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22378020 2012 The effect of NET-1 on the proliferation, migration and endocytosis of the SMMC-7721 HCC cell line.
22088470 2011 Genomics of hepatitis B virus-related hepatocellular carcinoma and adjacent noncancerous tissues with cDNA microarray.
21836059 2011 Tspan-1 interacts with the thiamine transporter-1 in human intestinal epithelial cells and modulates its stability.
21302622 Suppression of TSPAN1 by RNA interference inhibits proliferation and invasion of colon cancer cells in vitro.
20890423 2010 Clinicopathological significance of expression of Tspan-1, Jab1 and p27 in human hepatocellular carcinoma.
20680643 2011 Identification of metastasis-associated breast cancer genes using a high-resolution whole genome profiling approach.
19508227 2009 Glycosylation of tetraspanin Tspan-1 at four distinct sites promotes its transition through the endoplasmic reticulum.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19017553 2009 Tspan-1 is a tetraspanin preferentially expressed by mucinous and endometrioid subtypes of human ovarian carcinomas.
18822690 Clinicopathological significance of overexpression of TSPAN1, Ki67 and CD34 in gastric carcinoma.
17913940 2007 Association of NET-1 gene expression with human hepatocellular carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12115476 2002 Identification of a new proliferation-associated protein NET-1/C4.8 characteristic for a subset of high-grade cervical intraepithelial neoplasia and cervical carcinomas.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10719184 2000 Sequence and expression of seven new tetraspans.
9714763 1998 Sequences and expression of six new members of the tetraspanin/TM4SF family.