Property Summary

NCBI Gene PubMed Count 34
PubMed Score 71.97
PubTator Score 41.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 9.5e-05
intraductal papillary-mucinous adenoma (... 1.600 1.0e-02
intraductal papillary-mucinous carcinoma... 1.700 4.9e-03
lung cancer 1.300 2.5e-04
Multiple myeloma 1.136 2.1e-02
osteosarcoma -1.855 6.2e-07
Pick disease -1.200 8.6e-04
psoriasis -2.100 3.1e-05
Waldenstrons macroglobulinemia 1.294 2.0e-02

Protein-protein Interaction (10)

Gene RIF (20)

AA Sequence

MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRT      1 - 70
IFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTR     71 - 140
SLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGD    141 - 210
IDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKT    211 - 280
EMIDQEEGIS                                                                281 - 290
//

Text Mined References (40)

PMID Year Title