Property Summary

NCBI Gene PubMed Count 204
PubMed Score 624.16
PubTator Score 308.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.200 4.3e-02
cystic fibrosis -1.600 1.9e-03
Breast cancer -2.300 1.5e-60
ductal carcinoma in situ -2.300 4.2e-05
invasive ductal carcinoma -2.600 1.4e-04

Gene RIF (184)

PMID Text
26992000 study shows that specific food antigens can trigger innate immune mediated esophageal TSLP secretion
26879860 Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy.
26712523 The association of TSLP polymorphism rs2289278 with atopic dermatitis (AD) was stronger in children with allergic sensitization than in children without atopy, and TSLP polymorphisms also increased the risk of asthma in children with AD
26652578 Upon TSLP stimulation, the cells with the highest TSLPR expression level showed enhanced proliferation and JAK/STAT-mediated gene regulation in a dose-dependent manner
26573878 production by monocyte-derived dendritic cells requires the integration of signals from dectin-1, the IL-1 receptor, and endoplasmic reticulum stress response stress signaling pathways
26531761 TSLP expression in the skin is mediated via RARgamma-RXR pathways.
26531692 This study indicated that the elevation of microRNA-19b suppressed TSLP expression and then influenced T cell development in thymomatous Myasthenia gravis
26419317 Heat stress-induced HSPs can significantly reduce the production and secretion of TSLP from keratinocytes cultured under Th2 environment.
26288354 CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody
26175262 Correlation between TSLP overexpression and gastric cancer metastasis to lymph nodes indicate that TSLP plays a role in lymph node involvement in gastric cancer patients.
26095319 The positive feedback loop between TSLP, IL-33 and their receptors, and Th2 cytokines may facilitate Th2-skewed inflammation in eosinophilic CRSwNP.
26026341 TSLP downregulates filaggrin expression in human skin keratinocytes
26014813 The short TSLP isoform ameliorates experimental colitis in mice and prevents endotoxin shock. The long TSLP isoform is proinflammatory and is only expressed during inflammation.
25981737 TRAIL regulates MID1 and TSLP, inflammation, fibrosis, smooth muscle hypertrophy, and expression of inflammatory effector chemokines and cytokines in experimental eosinophilic esophagitis.
25979231 Results suggest that a high level of TSLP in cancer lesions mediated by hypoxia is an important regulator of the progression of cervical cancer by recruiting and licensing tumor-associated EOS to promote the growth of the cervical cancer cell itself.
25962901 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent
25889007 TSLP secreted by hepatocytes and keratinocytes of HCV-infected patients with CV is involved in the pathogenesis of vasculitis and may possibly support the therapeutic use of TSLP-targeted monoclonal antibodies.
25817699 Positive association exists between serum TSLP and anti-citrullinated peptide antibodies in patients with rheumatoid arthritis.
25763996 these results suggest that activation of the TSLP pathway is pivotal in the development of pulmonary pathology and pulmonary hMPV replication.
25705788 This article focuses on evidence for the role of IL-25, IL-33 and TSLP in human allergic disease; although this triad of cytokines is described as epithelial derived, it is clear that their expression within lung tissue is much more widespread.[Review]
25700684 Japanese women with certain TSLP genotypes had a significantly increased risk of eczema.
25680454 LIGHT controls TSLP to drive pulmonary fibrosis.
25676453 The levels of mRNA for TSLP and TSLPR were significantly elevated in parotid gland tissues from the KD group as compared to the control group.
25656998 TSLP and IL-33 modulate migration of hematopoietic progenitor cells in patients with allergic asthma.
25652868 Interstitial TSLP expression in breast tumors is associated with the prognosis and efficacy of adjuvant chemotherapy.
25515628 results show that rs1837253 polymorphism may be directly involved in the regulation of TSLP secretion.
25187315 Low expression of PPARgamma and high expression of TSLP in the duodenal mucosa of children with newly diagnosed Celiac disease suggest that they are involved in the pathophysiology of this disease
25171086 In the absence of TP63, keratinocytes readily presented TSLP and other cytokines by stimuli through Toll-like receptor 3.
24966899 In endometriosis, TSLP is involved in estrogen mediated regulation of the secretion of MCP-1 and IL-8, and the growth of endometrial stromal cells through JNK and NF-kappaB signal pathways.
24931369 airway epithelial cells TRPV1 activation potently induces allergic cytokine thymic stromal lymphopoietin (TSLP) release
24930783 Thymic stromal lymphopoietin: a central regulator of allergic asthma
24910175 TSLP synergized with CD40 ligand to promote dendritic cell activation and pathogenic IL-23 production by primary blood and skin dendritic cells.
24888572 DCs are primed in human asthma for TSLP-driven induction of both Th2 and Th9 cells.
24850429 short protein isoform is expressed in keratinocytes of oral cavity, skin and salivary glands, and exhibits a markedly stronger antibacterial activity compared to longer isoform
24831437 these results support epistasis between SPINK5 and TSLP, which contributes to childhood asthma.
24794807 Data suggest that thymic stromal lymphopoietin (TSLP) and interleukin-16 (IL-16), expressed at early stages of disease, function to recruit malignant T cells to the skin.
24792379 TSLP induces MUC5B expression via the ERK1/2 and p38 MAPK signaling pathway in human airway epithelial cells.
24782181 Thymic stromal lymphopoietin is a novel proinflammatory mediator in rheumatoid arthritis that potently activates CD1c+ myeloid dendritic cells to attract and stimulate T cells.
24773145 The data reveals a novel effect of allergen-specific T cells as a positive regulator of TSLP production by epithelial cells.
24698291 might be potential marker of eosinophilic oesophagitis
24652135 The three polymorphisms in the TSLP were present in the sample population of San Basilio de Palenque and its distribution is similar to that reported for African populations and African ancestry in America
24599138 It plays an important role as a master switch of allergic inflammation because it promotes Th2-type immune responses by inducing the activation of dendritic cells.
24525665 Variants in the gene encoding the TSLP protein may have differential effects on asthma phenotypes depending on gender, atopy, and the presence of allergic rhinitis.
24453244 trophoblast-derived thymic stromal lymphopoietin instructs decidual CD11c(+) dendritic cells with increased costimulatory molecules; MHC class II; and Th2/3-type, but not Th1-type, cytokines.
24410591 Data indicate that co-culture with multiple myeloma (MM) cells increases expression and secretion of thymic stromal lymphopoietin (TSLP in mesenchymal stem cells (MSCs).
24401911 TSLP gene variation maybe a potential therapeutic target for the treatment of chronic atopic dermatitis in children.
24397611 circulating TSLP was not significantly associated with eczema, allergen sensitization, or recurrent wheezing during the first three years of life.
24335833 demonstrate that plasmacytoid DCs, exposed to TSLP together with TLR ligands, acquire significant potential towards Th2 polarization
24220317 Increased density of intraepithelial mast cells in patients with exercise-induced bronchoconstriction regulated through epithelially derived thymic stromal lymphopoietin and IL-33.
24185116 Higher TGF-beta with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients.
24167583 TSLP stimulation can induce cellular senescence during airway remodeling in asthma. Inhibiting the signaling pathways of cellular senescence overcomes TSLP-induced airway remodeling
24081992 TSLP is a master regulator of type 2 immune responses beyond that of allergic inflammatory conditions and suggest a novel role for TSLP in the context of chronic fibrotic lung disease.
24028796 The results suggest that TSLP may down-regulate caspase3 expression through activation of the STAT3 pathway, thereby suppressing the apoptosis of decidual gammadelta T cells.
23953709 inflammasome activation has an inhibitory role on thymic stromal lymphopoietin mRNA expression and T(H)2 cell fate in the skin.
23872715 these data suggest that the TSLP-basophil axis contributes to the pathogenesis of eosinophilic esophagitis and could be therapeutically targeted to treat this disease.
23688414 Thymic stromal lymphopoietin activity is increased in nasal polyps of patients with chronic rhinosinusitis
23602531 Letter: serum TSLP was not elevated in chronic spontaneous urticaria.
23495958 This study has demonstrated that TSLP secreted by cervical carcinomas cells is involved in the angiogenesis of cervical cancer in a paracrine manner
23485611 Thymic stromal lymphopoietin could activate dendritic cells (DCs) to differentiate Th17 inflammation in naive CD4(+) T cells.
23433457 Originally shown to promote growth and activation of B cells, thymic stromal lymphopoietin (TSLP) is now known to have wide-ranging impacts on both hematopoietic and non-hematopoietic cell lineages. [REVIEW]
23413283 There is evidence of TSLP overexpression in systemic sclerosis and other non-allergic fibrotic conditions, and a demonstration of a profibrotic role that is potentially meditated by specific changes in the local cytokine milieu.
23376058 Interleukin-9 is required for allergic airway inflammation mediated by the cytokine TSLP.
23363980 These results demonstrate an essential role for IL-33- and IL-25-independent group 2 innate lymphoid cell in promoting skin inflammation.
23335246 TSLP is highly expressed in the skin of diffuse cutaneous systemic sclerosis patients and interacts in a complex manner with 2 other profibrotic cytokines, TGFbeta and IL-13.
23310954 The NF-kappaB binding site located in the proximal region of the TSLP promoter is critical for TSLP modulation in human intestinal epithelial cells.
23267211 TSLP may cause asthma by promoting innate allergic responses to indoor allergens and this contribution is significantly modified by smoking.
23200753 This study suggests that SNPs in TSLP gene may exert a gender and/or nasal polyposis-dependent risk for development of CRS in Chinese subjects.
23190696 Data indicate that thymic stromal lymphopoietin (TSLP) expression was induced by IL-32 via activation of caspase-1.
22981788 induced by respiratory syncytial virus-infected airway epithelial cells and promotes a type 2 response to infection
22973903 Single nucleotide polymorphisms in thymic stromal lymphopoietin gene are not associated with allergic rhinitis.
22913730 TSLP variants are significantly associated with bronchial asthma.
22888172 TSLP is up-regulated by interleukin (IL)-1b and may be involved in the development of endometriosis.
22806096 TSLP promotes influenza-specific CD8+ T-cell responses by augmenting local inflammatory dendritic cell function.
22764833 Thymic stromal lymphopoietin directly stimulates eosinophils to produce EETs (eosinophil extracellular traps).
22750414 This study suggests TSLP and other mediators released from epithelial cells in response to V. cholerae colonization actively influence dendritic cells in initiating inflammatory response.
22633328 Pathogens producing dsRNA, such as respiratory viral infections, might amplify local T(H)2 inflammation in asthmatic patients through the production of TSLP and IL-1 by epithelial cells and activation of T(H)2 cytokine production by mast cells.
22578802 Calcium regulates the level of TSLP through RIP2/caspase-1/NF-kappaB/IkappaBalpha signal.
22442496 TSLP may impact multiple disease states within multiple organ systems, including the blockade of TH1/TH17 responses and the promotion of cancer and autoimmunity
22355542 These studies indicate that IL-13 induces AD and atopic march via a TSLP dependent mechanism.
22317895 may upregulate c-Myc expression through activation of STAT3 pathway, thereby inducing trophoblast proliferation
22304237 Thymic stromal lymphopoietin is an immune cytokine gene associated with the metabolic syndrome and blood pressure in severe obesity.(
22274860 TSLP might also be involved in the pathogenesis of inflammatory bowel disease and progression of cancer
22189594 This review article summarizes the documented association between TSLP and human allergic disorders, and describes the cellular and molecular mechanisms by which TSLP activates DCs and induces allergic inflammation.
22168549 This review sums up diverse mechanisms that mediate TSLP/TSLP receptor-signalling network in chronic airway diseases.
22154513 These results indicate that human arytenoid fibroblasts strongly induce TSLP production with stimulation by double-stranded RNA.
22092577 TSLP exerts antimicrobial effects. The antimicrobial activity was mapped to the C-terminal region of the molecule.
21975173 TSLP expression is increased in a subset of patients with severe asthma.
21966427 Genetic variants in TSLP may contribute to asthma susceptibility in admixed urban populations with a gene and environment interaction.
21835441 IgE induces transcriptional regulation of thymic stromal lymphopoietin in human airway smooth muscle cells.
21820713 For the first time, we have shown that short ragweed pollen initiates TLR4-dependent TSLP/OX40L/OX40 signaling, which triggers T(H)2-dominant allergic inflammation
21772055 TSLP induced the polarization of both microtubule and actin cytoskeletons and promoted dendritic cells 3-dimensional migration in transwell as well as in microfabricated channels that mimic the confined environment of peripheral tissues.
21691053 dsRNA or RV16, induces overproduction of TSLP in COPD-BEC. dsRNA- and RV-induced overproduction of TNF-alpha and CXCL8 involves endosomal TLR3 and cytosolic RIG-I-like helicases
21690322 Human peripheral blood monocytes and monocyte-derived dendritic cells express TSLP.
21689850 Our data suggest that the effect of breast feeding on food sensitization (FS) was modified by SNPs in the IL12RB1, TLR9, and TSLP genes both individually and jointly.
21682736 Variation in genes encoding IL-33 and thymic stromal lymphopoietin (TSLP), and the IL1RL1 gene encoding the IL-33 receptor, play the central roles for innate immune response pathways in the pathogenesis of both asthma and allergic diseases. (Review)
21576506 progression of skin fibrosis in IL-13-induced atopic dermatitis occurs via TSLP/TSLPR-dependent but IL-13-independent novel mechanisms by promoting fibrocyte
21468164 Identify TSLP variants as a potential susceptibility locus to asthma and to lower lung function in non-COPD, nonasthmatic healthy subjects.
21463955 TSLP can be expressed and produced through caspase-1 and NF-kappaB in mast cells
21458958 analysis of secretion of thymic stromal lymphopoietin from human keratinocytes in response to Malassezia yeasts
21440421 Viral infection induces Thymic stromal lymphopoietin (TSLP) in human keratinocytes
21274737 TSLP enhances expression of CD80 in human CD14 positive monocytes/macrophages and promotes their differentiation to myeloid dendritic cells
21255094 Reduced filaggrin levels may influence innate immune responses via TLR stimuli and may contribute to the pathogenesis of inflammatory skin disease via TSLP expression.
21148792 These data suggest a novel important biological role for NF-kappaB pathway in TNF-alpha-induced TSLP expression in human airway smooth muscle cells.
21109746 Flagellin induces TSLP expression in keratinocytes via TLR5 and the expression can be upregulated by a cytokine milieu with Th2/TNF-alpha or TGF-alpha.
21085187 Comprehensive association analysis of candidate genes for generalized vitiligo supports XBP1, FOXP3, and TSLP.
21085187 Observational study of gene-disease association. (HuGE Navigator)
21055671 Increased skin expression and elevated serum levels in atopic dermatitis
21054781 The effect of TSLP on umbilical cord blood CD34(+) -derived Langerhans cells-like cells, was investigated.
20974963 role of JAK1 and JAK2 in TSLP-mediated STAT5 phosphorylation in mouse and human primary CD4(+) T cells, in contrast to the known activation of JAK1 and JAK3 by the related cytokine, IL-7
20924287 The role of TSLP in the pathogenesis of nasal polyps is reported.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20660708 Cigarette smoke-induced increase in airway contractility may be mediated via airway smooth muscle-derived increases in TSLP signaling.
20656951 TSLP genetic variants are significantly associated with bronchial asthma and pulmonary function
20656951 Observational study of gene-disease association. (HuGE Navigator)
20624642 Increased iNKT cells activated by TSLP, especially in patients with severe AD, might play an essential role in the innate allergic immune response in AD.
20560908 TSLP variants are associated with asthma in a sex-specific fashion
20560908 Observational study of gene-disease association. (HuGE Navigator)
20555350 injury to the stratum corneum induced the expression of TSLP in the epidermis
20538796 human trophoblasts may contribute to maternal-fetal tolerance by instructing dDCs to induce regulatory T(H)2 bias in human early pregnancy via TSLP
20501368 Dimethylsulfoxide induced significantly increased TSLP mRNA expression in bronchial epithelial cells in a concentration-dependent manner.
20466416 Genetic variants are associated with atopic dermatitis and eczema herpeticum
20466416 Observational study of gene-disease association. (HuGE Navigator)
20444170 Our findings show an association between TSLP and atopic dermatitis (AD)including both atopic eczema(AE) and nonAE and NAE.
20444169 TSLP is present in human breast milk with Levels significantly higher (p<0.001) at 3-5 days than at 11-26 days postpartum.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20335125 RSV infection can enhance the expressions of TSLP in human airway epithelial cells. IFN-gamma, anti-TLR3 and dexamethasone can inhibit the elevation of TSLP expression induced by RSV infection, but IL-4 synergistically enhances its expression.
20236697 Our data indicate that epithelial cells express TSLPR and that TSLP induces bronchial epithelial cell proliferation and increases injury repair through IL-13 production.
20228393 trophoblast cells express TSLP and TSLPR, suggesting that TSLP plays an important role in extravillous trophoblast invasion and placentation
20208534 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20173030 TSLP-activated human plasmacytoid dendritic cells secrete macrophage-derived chemokine CCL-22 and thymus- and activation-regulated chemokine CCL-17 but not T helper type (Th)1- or Th2-polarizing cytokines.
20146705 Roles of Thymic stromal lymphopoietin in immunity.
20127673 TSLP induced the tyrosine-phosphorylation of STAT5 and the proliferation of multilineage-commited progenitor cells, pro-B cells and pre-B cells. It increased the proportion and the absolute numbers of more mature human B cells.
20109311 produced by nasal polyp fibroblasts in response to stimulation by tumor necrosis factor alpha and a Th2 cytokine
20086239 TSLP potently transduced a unique T helper type 2 inducing compound signal in DCs. Whereas activation of nuclear factor kappaB (predominantly p50) drove DCs to produce OX40L to induce T(H)2 differentiation
20079130 Thymic stromal lymphopoietin expression is increased in nasal epithelial cells of patients with mugwort pollen sensitive-seasonal allergic rhinitis.
19968632 IL-17A and IL-25 had opposing effects on thymic stromal lymphopoietin regulation in human nasal epithelial cells
19857905 reulates maternal-fetal immune tolerance during early human pregnancy
19841072 These results, together with the finding that TSLP was expressed by the epithelial cells of human follicular gastritis, suggest that H. pylori can directly trigger epithelial cells to produce TSLP.
19770269 IL-7 and TSLP use different mechanisms to regulate human CD4(+) T cell homeostasis.
19763625 high expression of TSLP in the epithelium from patients with allergic rhinitis with recruitment and infiltration of dendritic cell
19741251 The TSLP protein produced in conjunctival epithelial cells plays a role in severe ocular allergy through the activation of dendritic cells and mast cells in synergy with other cytokines
19561109 TSLP expression is induced in airway epithelial cells by exposure to allergen-derived proteases and PAR-2 is involved in the process.
19555430 C allele at the TSLP -847C>T polymorphism may increase susceptibility to generalized vitiligo through decreasing TSLP mRNA expression levels.
19555430 Observational study of gene-disease association. (HuGE Navigator)
19539984 A genetic variant in the region of the thymic stromal lymphopoietin gene is associated with the phenotypes of asthma and airway hyperresponsiveness.
19539984 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19348931 Thymic stromal lymphopoietin as a mediator of crosstalk between bronchial smooth muscles and mast cells.
19187393 The data suggest that TSLP plays a role in augmenting, through DC recruitment and activation, the development of Th2-type T cells in allergic inflammation.
19164348 mast cells are able to store TSLP intracellularly and to produce TSLP following aggregation of FcepsilonRI in the presence of IL-4
19155513 The pathogenic phenotype that develops in the transgenic mouse lung in response to TSLP is governed almost exclusively by a TSLP-facilitated adaptive response directed against foreign antigen.
19056108 Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA.
19055649 Through DC activation, human TSLP and TLR3 ligands promote differentiation of Th17 cells with the central memory T cell phenotype under Th2-polarizing conditions.
18941246 Study of pathways engaged in transgenic model of thymic stromal lymphopoietin-driven airway inflammation demonstrates that simultaneous blockade of interleukin (IL)-13 and IL-4 can reverse established asthma-like chronic airway disease.
18832690 thymic stromal lymphopoietin (TSLP) and human DCs plays an essential role in evoking inflammatory Th2 responses in allergy through OX40 ligand expression on DCs.
18832669 Inhibition of NF-kappaB-mediated TSLP expression by retinoid X receptor
18802348 expression level is increased in patients with asthma
18802347 high expression in lungs of patients with asthma; undetectable expression in epithelial cells of patients with Crohn disease
18802341 expression correlates with presence/ severity of lesions in atopic dermatitis patients
18787178 Data suggest that functional genetic polymorphism of the TSLP gene appears to contribute to Th2-polarized immunity through higher TSLP production by bronchial epithelial cells in response to viral respiratory infections.
18768889 A TSLP-driven mouse model of inflammation exhibits many characteristics of human atopic dermatitis, including infiltrate of CD4-positive cells, eosinophils, mast cells; production of Th2 cytokines; and class switching to produce immunoglobulin E.
18757306 Data demonstrate that lysophosphatidic acid stimulates thymic stromal lymphopoietin and CCL20 expression in bronchial epithelial cells via CARMA3-mediated NF-kappaB activation.
18720075 TSLP was detected in all samples and the mRNA and protein expression of TSLP is increased significantly in allergic rhinitis nasal mucosa. TSLP production is tightly correlated with IL-4 and severity of allergic rhinitis.
18684970 There is distinct airways expression of TSLP and chemokines which preferentially attract T helper (Th) type 1- and Th2-type T cells, and influx of T cells bearing their receptors in asthma and chronic obstructive pulmonary disease.
18445339 REVIEW: effect of the functional versatility of hTSLP-activated DCs (hTSLP-DCs) on T cells
18244952 In a sex-stratified analysis, there was significant evidence of linkage to IgE to cockroach on chromosome 5q23; in female subjects,the T allele of single-nucleotide polymorphism rs2289276 in TSLP was associated with reductions in IgE to cockroach
18060034 OX40 ligand (OX40L) is a critical in vivo mediator of TSLP-mediated Th2 responses.
18049884 Dendritic cells exposed to diesel exhaust particle-treated human bronchial epithelial cells induced Th2 polarization in a thymic stromal lymphopoietin-dependent manner.
17959543 RSV F protein stimulates TSLP expression in human bronchial epithelial cells mediated partially by p38 and JNK signal pathways.
17666213 Master switch of allergic inflammation at epithelial cell and dendritic cell interface. Link between TSLP and atopic dermatitis and asthma. Review.
17635955 IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells
17513717 Human CD4-positive T cells are direct targets for thymic stromal lymphopoietin (TSLP).
17513456 human airway smooth muscle cells may play a role in chronic obstructive pulmonary disease airway inflammation via TSLP-dependent pathway
17416344 Collectively, these results suggest that TSLP, as a downstream molecule of TNF-alpha, may be involved in the pathophysiology of inflammatory arthritis.
17320941 TSLP, acting upstream of CD4-positive T cell responses, may provide a functional "missing link" between epithelial cells, Langerhans cells, and T-cell-mediated immunity.
17213320 inflammatory mediators IL-1beta and TNF-alpha regulate human TSLP gene expression in an NFkappaB-dependent manner
16785889 Review. TSLP influences the outcome of interactions between dendritic cells and CD4+ thymocytes and T cells in many situations.
15944327 Elevated bronchial mucosal expression of TSLP is implicated in asthma pathogenesis; its action is partly through selective development and retention, or recruitment of T helper type 2, not Th1, receptor-bearing cells.
15741223 TSLP is a major regulatory cytokine for CD40 ligand-induced IL-12 production by DCs, and TSLP-activated DCs could promote the persistence of Th2 inflammation even in the presence of IL-12-inducing signals
14999427 Reviewer points out that epithelial- and stromal-cell-derived TSLP may represent one of the factors initiating allergic responses, and that it could be a target for a curative therapeutic approach to allergy.
12707303 Data suggest that CD40L-expressing cells may act in combination with thymic stromal lymphopoietin to amplify and sustain pro-allergic responses.
12055625 Epithelial cell-derived TSLP not only potently activates dendritic cells, but also endows DCs with the ability to polarize naive T cells to produce proallergic Th2 cytokines.
11418668 This protein is a hemopoietic cytokine that signals through a heterodimeric receptor complex consisting of the human TSLP receptor and the IL-7R alpha-chain.

AA Sequence

MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCS      1 - 70
NRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQ     71 - 140
VSQLQGLWRRFNRPLLKQQ                                                       141 - 159
//

Text Mined References (207)

PMID Year Title
26992000 2016 Preferential Secretion of Thymic Stromal Lymphopoietin (TSLP) by Terminally Differentiated Esophageal Epithelial Cells: Relevance to Eosinophilic Esophagitis (EoE).
26879860 2016 Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy.
26712523 2016 TSLP polymorphisms, allergen exposures, and the risk of atopic disorders in children.
26652578 2016 Blockade of thymic stromal lymphopoietin (TSLP) receptor inhibits TSLP-driven proliferation and signalling in lymphoblasts from a subset of B-precursor ALL patients.
26573878 2016 TSLP production by dendritic cells is modulated by IL-1? and components of the endoplasmic reticulum stress response.
26531761 2016 TSLP expression in the skin is mediated via RAR?-RXR pathways.
26531692 2015 Aberrant decrease of microRNA19b regulates TSLP expression and contributes to Th17 cells development in myasthenia gravis related thymomas.
26419317 2016 Heat-shock pretreatment reduces expression and release of TSLP from keratinocytes under Th2 environment.
26288354 2015 TSLP Directly Interacts with Skin-Homing Th2 Cells Highly Expressing its Receptor to Enhance IL-4 Production in Atopic Dermatitis.
26175262 2015 Evaluation of thymic stromal lymphopoietin (TSLP) and its correlation with lymphatic metastasis in human gastric cancer.
26095319 2015 Interaction of thymic stromal lymphopoietin, IL-33, and their receptors in epithelial cells in eosinophilic chronic rhinosinusitis with nasal polyps.
26026341 2015 Thymic stromal lymphopoietin downregulates filaggrin expression by signal transducer and activator of transcription 3 (STAT3) and extracellular signal-regulated kinase (ERK) phosphorylation in keratinocytes.
26014813 2015 Dichotomy of short and long thymic stromal lymphopoietin isoforms in inflammatory disorders of the bowel and skin.
25981737 2015 TNF-related apoptosis-inducing ligand (TRAIL) regulates midline-1, thymic stromal lymphopoietin, inflammation, and remodeling in experimental eosinophilic esophagitis.
25979231 2015 The infiltration and functional regulation of eosinophils induced by TSLP promote the proliferation of cervical cancer cell.
25962901 2015 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent.
25889007 2015 Thymic stromal lymphopoietin in hepatitis C virus-related cryoglobulinemic vasculitis: gene expression level and protein distribution.
25817699 2015 Positive association between serum thymic stromal lymphopoietin and anti-citrullinated peptide antibodies in patients with rheumatoid arthritis.
25763996 2015 Human metapneumovirus infection activates the TSLP pathway that drives excessive pulmonary inflammation and viral replication in mice.
25705788 2015 Epithelial cytokines and pulmonary allergic inflammation.
25700684 2015 Association Between TSLP Polymorphisms and Eczema in Japanese Women: the Kyushu Okinawa Maternal and Child Health Study.
25680454 2015 Tumor necrosis factor superfamily 14 (LIGHT) controls thymic stromal lymphopoietin to drive pulmonary fibrosis.
25676453 2015 Increased expression of thymic stromal lymphopoietin and its receptor in Kimura's disease.
25656998 2015 Thymic stromal lymphopoietin and IL-33 modulate migration of hematopoietic progenitor cells in patients with allergic asthma.
25652868 2015 [The expression of thymic stromal lymphopoietin in primary tumors of breast cancer is associated with prognosis].
25515628 2015 Thymic stromal lymphopoietin (TSLP) secretion from human nasal epithelium is a function of TSLP genotype.
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25187315 2014 Peroxisome proliferator-activated receptor-? and thymic stromal lymphopoietin are involved in the pathophysiology of childhood coeliac disease.
25171086 2014 ?Np63 controls a TLR3-mediated mechanism that abundantly provides thymic stromal lymphopoietin in atopic dermatitis.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24966899 2014 TSLP induced by estrogen stimulates secretion of MCP-1 and IL-8 and growth of human endometrial stromal cells through JNK and NF-?B signal pathways.
24931369 2014 Activation of TRPV1 mediates thymic stromal lymphopoietin release via the Ca2+/NFAT pathway in airway epithelial cells.
24930783 2014 Thymic stromal lymphopoietin: a central regulator of allergic asthma.
24910175 2014 Thymic stromal lymphopoietin links keratinocytes and dendritic cell-derived IL-23 in patients with psoriasis.
24888572 2014 Myeloid dendritic cells are primed in allergic asthma for thymic stromal lymphopoietin-mediated induction of Th2 and Th9 responses.
24850429 2015 The short form of TSLP is constitutively translated in human keratinocytes and has characteristics of an antimicrobial peptide.
24831437 2014 Epistasis between serine protease inhibitor Kazal-type 5 (SPINK5) and thymic stromal lymphopoietin (TSLP) genes contributes to childhood asthma.
24794807 2015 CCR4+T cell recruitment to the skin in mycosis fungoides: potential contributions by thymic stromal lymphopoietin and interleukin-16.
24792379 2014 Effect of thymic stromal lymphopoietin on MUC5B expression in human airway epithelial cells.
24782181 2014 Thymic stromal lymphopoietin, a novel proinflammatory mediator in rheumatoid arthritis that potently activates CD1c+ myeloid dendritic cells to attract and stimulate T cells.
24773145 2014 T cell-mediated induction of thymic stromal lymphopoietin in differentiated human primary bronchial epithelial cells.
24698291 2014 Serum immunoglobulin free light chain levels are higher in girls than boys during eosinophilic oesophagitis.
24652135 [Distribution of three polymorphisms of the TSLP gen in African-descendent population from San Basilio de Palenque, Colombia].
24599138 2014 Exacerbation of allergic diseases by chemicals: role of TSLP.
24525665 2014 The genetic variants of thymic stromal lymphopoietin protein in children with asthma and allergic rhinitis.
24453244 2014 Embryonic trophoblasts induce decidual regulatory T cell differentiation and maternal-fetal tolerance through thymic stromal lymphopoietin instructing dendritic cells.
24410591 2014 Induction of thymic stromal lymphopoietin in mesenchymal stem cells by interaction with myeloma cells.
24401911 2014 Thymic stromal lymphopoietin variation, filaggrin loss of function, and the persistence of atopic dermatitis.
24397611 2014 Circulating TSLP associates with decreased wheezing in non-atopic preschool children: data from the URECA birth cohort.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24335833 2013 Plasmacytoid DCs, exposed to TSLP in synergy with TLR ligands, acquire significant potential towards Th2 polarization.
24220317 2014 Increased density of intraepithelial mast cells in patients with exercise-induced bronchoconstriction regulated through epithelially derived thymic stromal lymphopoietin and IL-33.
24185116 2014 Higher TGF-? with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients.
24167583 2013 Central role of cellular senescence in TSLP-induced airway remodeling in asthma.
24081992 2013 Evidence for a functional thymic stromal lymphopoietin signaling axis in fibrotic lung disease.
24028796 2013 Thymic stromal lymphopoietin suppresses the apoptosis of decidual gamma-delta T cells via regulation of the signal transduction and activation of transcription 3/caspase-3 signaling pathway.
23953709 2013 Antagonistic effect of the inflammasome on thymic stromal lymphopoietin expression in the skin.
23872715 2013 Thymic stromal lymphopoietin-elicited basophil responses promote eosinophilic esophagitis.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23688414 2013 Thymic stromal lymphopoietin activity is increased in nasal polyps of patients with chronic rhinosinusitis.
23602531 2013 Histamine, TNF, C5a, IL-6, -9, -18, -31, -33, TSLP, neopterin, and VEGF are not elevated in chronic spontaneous urticaria.
23495958 2013 Cervical carcinoma cells stimulate the angiogenesis through TSLP promoting growth and activation of vascular endothelial cells.
23485611 2013 Thymic stromal lymphopoietin over-expressed in human atherosclerosis: potential role in Th17 differentiation.
23433457 2013 The biology of thymic stromal lymphopoietin (TSLP).
23413283 2013 A profibrotic role for thymic stromal lymphopoietin in systemic sclerosis.
23376058 2013 Interleukin-9 is required for allergic airway inflammation mediated by the cytokine TSLP.
23363980 2013 TSLP elicits IL-33-independent innate lymphoid cell responses to promote skin inflammation.
23335246 2013 Thymic stromal lymphopoietin is up-regulated in the skin of patients with systemic sclerosis and induces profibrotic genes and intracellular signaling that overlap with those induced by interleukin-13 and transforming growth factor ?.
23310954 2013 The NF-?B binding site located in the proximal region of the TSLP promoter is critical for TSLP modulation in human intestinal epithelial cells.
23267211 2013 A distinct sensitization pattern associated with asthma and the thymic stromal lymphopoietin (TSLP) genotype.
23200753 2013 Polymorphisms in thymic stromal lymphopoietin gene demonstrate a gender and nasal polyposis-dependent association with chronic rhinosinusitis.
23190696 2012 Interleukin-32-induced thymic stromal lymphopoietin plays a critical role in macrophage differentiation through the activation of caspase-1 in vitro.
22981788 2012 Thymic stromal lymphopoietin is induced by respiratory syncytial virus-infected airway epithelial cells and promotes a type 2 response to infection.
22973903 2012 Single nucleotide polymorphisms in thymic stromal lymphopoietin gene are not associated with allergic rhinitis susceptibility in Chinese subjects.
22913730 2012 Two single nucleotide polymorphisms in TSLP gene are associated with asthma susceptibility in Chinese Han population.
22888172 2012 Interleukin-1? stimulates the secretion of thymic stromal lymphopoietin (TSLP) from endometrioma stromal cells: possible involvement of TSLP in endometriosis.
22806096 2013 TSLP promotes influenza-specific CD8+ T-cell responses by augmenting local inflammatory dendritic cell function.
22764833 2012 Thymic stromal lymphopoietin stimulates the formation of eosinophil extracellular traps.
22750414 2012 Human epithelial cells stimulated with Vibrio cholerae produce thymic stromal lymphopoietin and promote dendritic cell-mediated inflammatory Th2 response.
22633328 2012 Airway epithelial cells activate TH2 cytokine production in mast cells through IL-1 and thymic stromal lymphopoietin.
22578802 2012 Thymic stromal lymphopoietin is regulated by the intracellular calcium.
22442496 2012 The multiple facets of thymic stromal lymphopoietin (TSLP) during allergic inflammation and beyond.
22355542 2011 The Role of TSLP in IL-13-induced atopic march.
22317895 2012 Thymic stromal lymphopoietin promotes the proliferation of human trophoblasts via phosphorylated STAT3-mediated c-Myc upregulation.
22304237 2012 Thymic stromal lymphopoietin: an immune cytokine gene associated with the metabolic syndrome and blood pressure in severe obesity.
22274860 2012 Functions of thymic stromal lymphopoietin in immunity and disease.
22189594 2012 Cellular and molecular mechanisms of TSLP function in human allergic disorders--TSLP programs the "Th2 code" in dendritic cells.
22168549 2012 Function and mechanisms of TSLP/TSLPR complex in asthma and COPD.
22154513 2012 CpG-DNA suppresses poly(I:C)-induced TSLP production in human laryngeal arytenoid fibroblasts.
22092577 2011 Thymic stromal lymphopoietin exerts antimicrobial activities.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21975173 2012 Increased expression of immunoreactive thymic stromal lymphopoietin in patients with severe asthma.
21966427 2011 Genetic variants of TSLP and asthma in an admixed urban population.
21835441 2011 IgE induces transcriptional regulation of thymic stromal lymphopoietin in human airway smooth muscle cells.
21820713 2011 Short ragweed pollen triggers allergic inflammation through Toll-like receptor 4-dependent thymic stromal lymphopoietin/OX40 ligand/OX40 signaling pathways.
21804549 2011 Meta-analysis of genome-wide association studies of asthma in ethnically diverse North American populations.
21804548 2011 Genome-wide association study identifies three new susceptibility loci for adult asthma in the Japanese population.
21772055 2011 The human cytokine TSLP triggers a cell-autonomous dendritic cell migration in confined environments.
21691053 2012 Viral stimuli trigger exaggerated thymic stromal lymphopoietin expression by chronic obstructive pulmonary disease epithelium: role of endosomal TLR3 and cytosolic RIG-I-like helicases.
21690322 2011 Thymic stromal lymphopoietin is produced by dendritic cells.
21689850 2011 Gene polymorphisms, breast-feeding, and development of food sensitization in early childhood.
21682736 2011 The genetics of asthma and allergic disease: a 21st century perspective.
21576506 2011 IL-13 induces skin fibrosis in atopic dermatitis by thymic stromal lymphopoietin.
21468164 2011 Lower FEV1 in non-COPD, nonasthmatic subjects: association with smoking, annual decline in FEV1, total IgE levels, and TSLP genotypes.
21463955 2011 Thymic stromal lymphopoietin is expressed and produced by caspase-1/NF-?B pathway in mast cells.
21458958 2011 Secretion of thymic stromal lymphopoietin from human keratinocytes in response to Malassezia yeasts.
21440421 2011 Viral infection induces Thymic stromal lymphopoietin (TSLP) in human keratinocytes.
21439160 Novel cytokines and cytokine-producing T cells in allergic disorders.
21274737 2011 Human thymic stromal lymphopoietin enhances expression of CD80 in human CD14+ monocytes/macrophages.
21255094 2011 Filaggrin knockdown and Toll-like receptor 3 (TLR3) stimulation enhanced the production of thymic stromal lymphopoietin (TSLP) from epidermal layers.
21178477 Basophils induce Th2 immunity: is this final answer?
21148792 2011 Essential role of NF-?B and AP-1 transcription factors in TNF-?-induced TSLP expression in human airway smooth muscle cells.
21109746 2011 Flagellin induces the expression of thymic stromal lymphopoietin in human keratinocytes via toll-like receptor 5.
21109412 2010 The role of thymic stromal lymphopoietin (TSLP) in allergic disorders.
21085187 2011 Comprehensive association analysis of candidate genes for generalized vitiligo supports XBP1, FOXP3, and TSLP.
21055671 2010 Increased affected skin gene expression and serum levels of thymic stromal lymphopoietin in atopic dermatitis.
21054781 2011 CD34+ -derived Langerhans cell-like cells are different from epidermal Langerhans cells in their response to thymic stromal lymphopoietin.
20974963 2010 Thymic stromal lymphopoietin-mediated STAT5 phosphorylation via kinases JAK1 and JAK2 reveals a key difference from IL-7-induced signaling.
20924287 2011 Role of thymic stromal lymphopoietin in the pathogenesis of nasal polyposis.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20660708 2010 Thymic stromal lymphopoietin in cigarette smoke-exposed human airway smooth muscle.
20656951 2011 Thymic stromal lymphopoietin gene promoter polymorphisms are associated with susceptibility to bronchial asthma.
20624642 2010 Thymic stromal lymphopoietin-activated invariant natural killer T cells trigger an innate allergic immune response in atopic dermatitis.
20560908 2010 TSLP polymorphisms are associated with asthma in a sex-specific fashion.
20555350 2010 Injury to the stratum corneum induces in vivo expression of human thymic stromal lymphopoietin in the epidermis.
20538796 2010 Thymic stromal lymphopoietin from trophoblasts induces dendritic cell-mediated regulatory TH2 bias in the decidua during early gestation in humans.
20501368 2010 [Dimethylsulfoxide-induced expression of thymic stromal lymphopoietin in human bronchial epithelial cells].
20466416 2010 Genetic variants in thymic stromal lymphopoietin are associated with atopic dermatitis and eczema herpeticum.
20444170 2010 Increased serum thymic stromal lymphopoietin in children with atopic dermatitis.
20444169 2010 Thymic stromal lymphopoietin is present in human breast milk.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20335125 2010 [Effects of different factors on the expression of thymic stromal lymphopoietin in respiratory syncytial virus-infected human airway epithelial cells].
20300138 2010 Sensing the outside world: TSLP regulates barrier immunity.
20236697 2010 Thymic stromal lymphopoietin-induced human asthmatic airway epithelial cell proliferation through an IL-13-dependent pathway.
20228393 2010 Functional regulation of thymic stromal lymphopoietin on proliferation and invasion of trophoblasts in human first-trimester pregnancy.
20208534 2010 Common variants at 5q22 associate with pediatric eosinophilic esophagitis.
20173030 2010 Thymic stromal lymphopoietin-activated plasmacytoid dendritic cells induce the generation of FOXP3+ regulatory T cells in human thymus.
20146705 2010 Thymic stromal lymphopoietin.
20143171 2010 The role of thymic stromal lymphopoietin in allergic inflammation and chronic obstructive pulmonary disease.
20127673 2010 Thymic stromal lymphopoietin induces early human B-cell proliferation and differentiation.
20109311 Synergistic induction of thymic stromal lymphopoietin by tumor necrosis factor alpha and Th2 cytokine in nasal polyp fibroblasts.
20086239 2010 Distinct signal codes generate dendritic cell functional plasticity.
20079130 2009 Thymic stromal lymphopoietin expression is increased in nasal epithelial cells of patients with mugwort pollen sensitive-seasonal allergic rhinitis.
20016474 2010 The influence of TSLP on the allergic response.
19968632 2010 Opposing roles of IL-17A and IL-25 in the regulation of TSLP production in human nasal epithelial cells.
19857905 2009 The regulatory role of thymic stromal lymphopoietin (TSLP) in maternal-fetal immune tolerance during early human pregnancy.
19841072 2010 Helicobacter pylori promotes the production of thymic stromal lymphopoietin by gastric epithelial cells and induces dendritic cell-mediated inflammatory Th2 responses.
19770269 2009 TSLP and IL-7 use two different mechanisms to regulate human CD4+ T cell homeostasis.
19763625 2009 Thymic stromal lymphopoietin enhances tight-junction barrier function of human nasal epithelial cells.
19741251 2010 Functional role of thymic stromal lymphopoietin in chronic allergic keratoconjunctivitis.
19561109 2009 Proteases induce production of thymic stromal lymphopoietin by airway epithelial cells through protease-activated receptor-2.
19555430 2009 Association of thymic stromal lymphopoietin gene -847C>T polymorphism in generalized vitiligo.
19539984 2009 A thymic stromal lymphopoietin gene variant is associated with asthma and airway hyperresponsiveness.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19400908 2009 Thymic stromal lymphopoietin, OX40-ligand, and interleukin-25 in allergic responses.
19348931 2009 Thymic stromal lymphopoietin as a mediator of crosstalk between bronchial smooth muscles and mast cells.
19231591 2009 TSLP in epithelial cell and dendritic cell cross talk.
19198610 2009 Sequence variants affecting eosinophil numbers associate with asthma and myocardial infarction.
19187393 2009 Early production of thymic stromal lymphopoietin precedes infiltration of dendritic cells expressing its receptor in allergen-induced late phase cutaneous responses in atopic subjects.
19164348 2009 FcepsilonRI-mediated thymic stromal lymphopoietin production by interleukin-4-primed human mast cells.
19155513 2009 TSLP conditions the lung immune environment for the generation of pathogenic innate and antigen-specific adaptive immune responses.
19056108 2009 Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA.
19055649 2009 Human TSLP and TLR3 ligands promote differentiation of Th17 cells with a central memory phenotype under Th2-polarizing conditions.
18941246 2008 Reversal of thymic stromal lymphopoietin-induced airway inflammation through inhibition of Th2 responses.
18836588 Therapy directed against thymic stromal lymphopoietin.
18832690 2008 Imidazoquinoline acts as immune adjuvant for functional alteration of thymic stromal lymphopoietin-mediated allergic T cell response.
18832669 2008 Cutting edge: Inhibition of NF-kappaB-mediated TSLP expression by retinoid X receptor.
18802348 2008 Lung dendritic cells: targets for therapy in allergic disease.
18802347 2008 Control and regulation of peripheral tolerance in allergic inflammatory disease: therapeutic consequences.
18802341 2008 Regulatory role of T lymphocytes in atopic dermatitis.
18787178 2009 Functional analysis of the thymic stromal lymphopoietin variants in human bronchial epithelial cells.
18768889 2008 Intradermal administration of thymic stromal lymphopoietin induces a T cell- and eosinophil-dependent systemic Th2 inflammatory response.
18757306 2009 CARMA3 mediates lysophosphatidic acid-stimulated cytokine secretion by bronchial epithelial cells.
18720075 2009 Overexpression of thymic stromal lymphopoietin in allergic rhinitis.
18684970 2008 Expression and cellular provenance of thymic stromal lymphopoietin and chemokines in patients with severe asthma and chronic obstructive pulmonary disease.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18450510 2008 Thymic stromal lymphopoietin: a new cytokine in asthma.
18445339 2008 Human TSLP-educated DCs.
18244952 2008 Sex-stratified linkage analysis identifies a female-specific locus for IgE to cockroach in Costa Ricans.
18060034 2007 In vivo blockade of OX40 ligand inhibits thymic stromal lymphopoietin driven atopic inflammation.
18049884 2008 Diesel exhaust particle-exposed human bronchial epithelial cells induce dendritic cell maturation and polarization via thymic stromal lymphopoietin.
17959543 2007 [Signal transduction in respiratory syncytial virus infection-induced thymic stromal lymphopoietin expression in human epithelial cells].
17666213 2007 Thymic stromal lymphopoietin and OX40 ligand pathway in the initiation of dendritic cell-mediated allergic inflammation.
17635955 2007 IL-25 augments type 2 immune responses by enhancing the expansion and functions of TSLP-DC-activated Th2 memory cells.
17513717 2007 Cutting edge: direct action of thymic stromal lymphopoietin on activated human CD4+ T cells.
17513456 2007 Constitutive and inducible thymic stromal lymphopoietin expression in human airway smooth muscle cells: role in chronic obstructive pulmonary disease.
17416344 2007 A possible role for TSLP in inflammatory arthritis.
17320941 2007 Thymic stromal lymphopoietin converts human epidermal Langerhans cells into antigen-presenting cells that induce proallergic T cells.
17242164 2007 Thymic stromal lymphopoietin is released by human epithelial cells in response to microbes, trauma, or inflammation and potently activates mast cells.
17213320 2007 Inducible expression of the proallergic cytokine thymic stromal lymphopoietin in airway epithelial cells is controlled by NFkappaB.
17129180 2007 TSLP: an epithelial cell cytokine that regulates T cell differentiation by conditioning dendritic cell maturation.
16899198 2006 Thymic stromal lymphopoietin:a potential therapeutic target for allergy and asthma.
16785889 2006 Thymic stromal lymphopoietin in normal and pathogenic T cell development and function.
16782024 2006 Tweaking of memory T helper 2 cells by TSLP.
16432252 2006 Thymic stromal lymphopoietin: master switch for allergic inflammation.
15944327 2005 Thymic stromal lymphopoietin expression is increased in asthmatic airways and correlates with expression of Th2-attracting chemokines and disease severity.
15741223 2005 Human TSLP promotes CD40 ligand-induced IL-12 production by myeloid dendritic cells but maintains their Th2 priming potential.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14999427 2004 Human thymic stromal lymphopoietin: a novel epithelial cell-derived cytokine and a potential key player in the induction of allergic inflammation.
12707303 2003 Human dendritic cells activated by TSLP and CD40L induce proallergic cytotoxic T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11480573 2001 Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation.
11418668 2001 Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.
10570284 1999 Requirement for stat5 in thymic stromal lymphopoietin-mediated signal transduction.