Property Summary

NCBI Gene PubMed Count 21
PubMed Score 32.25
PubTator Score 21.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.100 1.1e-02
atypical teratoid / rhabdoid tumor -1.900 5.4e-04
tuberculosis 1.700 1.7e-05
cystic fibrosis -1.200 5.6e-04
group 3 medulloblastoma 1.900 3.7e-02
mucosa-associated lymphoid tissue lympho... 1.388 4.8e-02
ovarian cancer -1.900 1.5e-12
pituitary cancer -1.600 6.5e-05

Gene RIF (5)

PMID Text
23671695 The dynamic expression of Sox9 and the interaction between TSHZ3, SOX9 and MYOCD provide a mechanism that regulates the pace the myogenic program in the ureter.
21423795 TSHZ3 gene promoter was found to be methylated in all the breast/prostate cancer cell lines and some of the breast cancer clinical specimens while the TSHZ2 gene promoter was unmethylated except for the MDA-MB-231 breast cancer cell line.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19745106 Mutations in TSHZ2 and TSHZ3 are not a major cause of pelvi-ureteric junction obstruction, at least in Albanian and Macedonian populations.
19745106 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCH      1 - 70
EMDSESHISETSDRMADFESGSIKNEEETKEVTVPLEDTTVSDSLEQMKAVYNNFLSNSYWSNLNLNLHQ     71 - 140
PSSEKNNGSSSSSSSSSSSCGSGSFDWHQSAMAKTLQQVSQSRMLPEPSLFSTVQLYRQSSKLYGSIFTG    141 - 210
ASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYC    211 - 280
GHSFESLQDLSVHMIKTKHYQKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTND    281 - 350
ALQKNSNPYITPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMK    351 - 420
KGKPIVETPVTPTITTLLDEKVQSVPLAATTFTSPSNTPASISPKLNVEVKKEVDKEKAVTDEKPKQKDK    421 - 490
PGEEEEKCDISSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNGTPSWGGYPSIHAAYQLPNMM    491 - 560
KLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTSPMPKTNFHAMEELVKKVTEKVAKVEEKMKE    561 - 630
PDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLAS    631 - 700
SLSGSTAIITDHPPEQPFVNPLSALQSVMNIHLGKAAKPSLPALDPMSMLFKMSNSLAEKAAVATPPPLQ    701 - 770
SKKADHLDRYFYHVNNDQPIDLTKGKSDKGCSLGSVLLSPTSTAPATSSSTVTTAKTSAVVSFMSNSPLR    771 - 840
ENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNPQHLLILQAQF    841 - 910
AASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPVFFCND    911 - 980
CASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINSQIAQTKSPSEKMVTSSPEEDLGTSYQCKLCNRTF    981 - 1050
ASKHAVKLHLSKTHGKSPEDHLLYVSELEKQ                                          1051 - 1081
//

Text Mined References (26)

PMID Year Title
27381532 2016 Sonic hedgehog, TBX18, and TSHZ3 proteins involved in pyeloureteral motility development are overexpressed in ureteropelvic junction obstruction. An immunohistochemical, histopathological, and clinical comparative study.
25390934 2014 Whole-genome sequencing of the world's oldest people.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
24076275 2014 Altered epigenetic regulation of homeobox genes in human oral squamous cell carcinoma cells.
23671695 2013 TSHZ3 and SOX9 regulate the timing of smooth muscle cell differentiation in the ureter by reducing myocardin activity.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21543328 2011 Teashirt-3, a novel regulator of muscle differentiation, associates with BRG1-associated factor 57 (BAF57) to inhibit myogenin gene expression.
21423795 2011 Rare and frequent promoter methylation, respectively, of TSHZ2 and 3 genes that are both downregulated in expression in breast and prostate cancers.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19745106 2010 Analysis of TSHZ2 and TSHZ3 genes in congenital pelvi-ureteric junction obstruction.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
18776146 2008 Teashirt 3 is necessary for ureteral smooth muscle differentiation downstream of SHH and BMP4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.