Property Summary

NCBI Gene PubMed Count 15
PubMed Score 252.71
PubTator Score 65.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.015 5.7e-03
atypical teratoid / rhabdoid tumor -1.600 1.5e-03
cystic fibrosis 1.739 2.6e-05
group 3 medulloblastoma 1.200 1.3e-02
juvenile dermatomyositis 1.352 9.8e-10
oligodendroglioma 1.100 7.1e-03
osteosarcoma 2.099 2.5e-06
ovarian cancer 1.300 3.2e-03
pancreatic ductal adenocarcinoma liver m... -1.323 7.8e-03
pituitary cancer 1.100 1.6e-04
primitive neuroectodermal tumor 1.100 4.4e-02
Rheumatoid arthritis 1.100 2.7e-02
ulcerative colitis -1.500 2.1e-05

Gene RIF (7)

AA Sequence

MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQNSPVSSATNQ      1 - 70
DAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSG     71 - 140
STTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQ    141 - 210
TSSYGLLPEPSLFSTVQLYRQNNKLYGSVFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDS    211 - 280
EKTKRWSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPS    281 - 350
TKKRALQDLAPPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME    351 - 420
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPASSIKKQPDSP    421 - 490
AGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREEDLDDSPKGGLDILKSLENTVS    491 - 560
TAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQVQPSYAGGVKSLSSAEHNALLHSPGSLTPP    561 - 630
PHKSNVSAMEELVEKVTGKVNIKKEERPPEKEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETG    631 - 700
KAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDP    701 - 770
LAMLYKISNSMLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI    771 - 840
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLILQAQFASSLRE    841 - 910
TTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPVFFCNDCASQFR    911 - 980
TASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTNKTLGPLGATEEDLGSTFQCKLCNRTFASKH    981 - 1050
AVKLHLSKTHGKSPEDHLIYVTELEKQ                                              1051 - 1077
//

Text Mined References (18)

PMID Year Title