Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.3e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.3e-02

Synonym

Accession Q3SY00 Q3SXZ9 Q3SY01 Q96M26
Symbols FAM161C

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MGQDTDMLNTYQQLVRTPSVRPGQDVRLQAPGTRTGLLKLLSTVSQDKQGCLGSGDGVPNQDLQQRSQSS      1 - 70
RQTAKKDRKPRGQSKKGQGSEESEDHFPLLPRKPSFPFQWAWESIATDVRAVLQPSSPTPGHQALPMPSS     71 - 140
FSQRQSRRKSTANLPEAHGCCWKTEAQNLKARQQLGAWGGVSIPTGKGELGSEPPSGLQLPGRRPGSGSA    141 - 210
SDKQVQLQSLGAEEAERGLSSGVLPQRPRRGSISEEEQFSEATEEAEEGEHRTPCRRRAGCQRKGQISGE    211 - 280
EASDEGEVQGQSQGSSPSFNNLRRRQWRKTRAKELQGPWDLEKLHRQLQRDLDCGPQKLPWKTLRAAFQA    281 - 350
SKRNGKAYASGYDETFVSANLPNRTFHKRQEATRSLLQAWERQRQEERQQAELRRARTQHVQRQVAHCLA    351 - 420
AYAPRGSRGPGAAQRKLEELRRQERQRFAEYQAELQGIQHRVQARPFLFQQAMQANARLTVTRRFSQVLS    421 - 490
ALGLDEEQLLSEAGKVDREGTPRKPRSHRSMGVRMEHSPQRPPRTEPTGSQPDRHYNPSLDPECSP        491 - 556
//

Text Mined References (5)

PMID Year Title