Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.27
PubTator Score 15.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 1.5e-03
intraductal papillary-mucinous adenoma (... 1.100 1.1e-03
lung carcinoma 1.400 2.0e-06
malignant mesothelioma -2.200 1.1e-07
nasopharyngeal carcinoma -1.100 2.4e-06
osteosarcoma 1.092 9.0e-04
pituitary cancer 1.500 3.9e-05

Gene RIF (8)

AA Sequence

MMRSRSKSPRRPSPTARGANCDVELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLLYEQ      1 - 70
AQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHL     71 - 140
EQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENT    141 - 210
EKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKK    211 - 280
SENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDIL    281 - 350
AHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKA    351 - 420
NEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKM    421 - 490
EEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANE    491 - 560
RISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDIT    561 - 630
KRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF      631 - 698
//

Text Mined References (22)

PMID Year Title