Property Summary

NCBI Gene PubMed Count 146
PubMed Score 282.11
PubTator Score 228.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Breast Cancer, Familial 12
Disease Target Count P-value
ovarian cancer 8491 8.3e-05
Multiple myeloma 1327 1.1e-04
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.403 1.1e-04
ovarian cancer 2.200 8.3e-05

Protein-protein Interaction (2)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
485342 confirmatory 0 / 3 / 1277 qHTS Validation Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101
485388 summary 0 / 0 / 0 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Summary
493005 confirmatory 2 / 1803 / 334923 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101
651599 confirmatory 17 / 70 / 494 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation in TR assay
651600 confirmatory 163 / 197 / 221 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation
651603 other 5 / 0 / 0 qHTS Assay for Iinhibitors of HIV-1 Budding by Blocking the Interaction of PTAP/TSG101: Hit Validation in Viral Budding Asaay

Gene RIF (162)

PMID Text
26608825 Results show that TSG101 bidirectionally modulates cell invasion through regulating MMP-9 mRNA expression in different cell types.
26537625 TSG101 plays an important role in the development of hepatocellular carcinoma
26457367 PSAP motif of OFR3 is required for hepatitis E virus exit and interaction with host TSG101.
26400331 Expression of tsg101 mRNA and of TSG101 protein were significantly higher in the oxaliplatin resistant cell line than parent HT-29 cels.
26317613 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26268989 siRNA knockdown of TSG101 impairs terminal cleavage of p24/p2 to p24 and HIV release is impaired (from sequential transfection of siRNA followed by plasmid HIVdeltaEnv (pBH10)); HIV release is enhanced by TSG101
26109641 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26066081 Stress-internalized EGFR is retained intracellularly by continued p38 activity in a mechanism involving ubiquitin-independent, ESCRT/ALIX-dependent incorporation onto intraluminal vesicles (ILVs) of MVBs
25973004 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25973004 siRNA knockdown of TSG101 impairs terminal cleavage of p24/p2 to p24 and HIV release is impaired (from sequential transfection of siRNA followed by plasmid HIVdeltaEnv (pBH10)); HIV release is enhanced by TSG101
25919665 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25749978 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25710462 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25633977 siRNA knockdown of TSG101 impairs terminal cleavage of p24/p2 to p24 and HIV release is impaired (from sequential transfection of siRNA followed by plasmid HIVdeltaEnv (pBH10)); HIV release is enhanced by TSG101
25510868 our findings strongly suggest that TSG101 is a cellular target for HSV-1 tegument ubiquitin specific protease activity during infection.
25488808 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25330247 Tsg101 is necessary for the efficient transport and release of nucleocapsids in marburg virus-infected cells
25099357 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25010273 The ESCRT component TSG101 is required for optimal Human papillomavirus 16 infection.
24522922 Authors describe a novel compound (compound 0013) that blocks the JUNV Z-Tsg101 interaction and inhibits budding of virus-like particles.
24436186 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24244542 Our findings thus indicate that TSG101 regulation of p21 is an important factor in the cellular function of TSG101.
24237697 These data support the interferon-induced generation of a Tsg101- and ISG15-dependent checkpoint in the secretory pathway that compromises influenza virus release.
24107264 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23933150 Knock down of TSG101 causes the EGFR to accumulate in low density endosomes.
23895345 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23408603 These results support a model in which both HIV-1 Gag-induced membrane curvature and Gag-ESCRT interactions promote tetherin recruitment, but the recruitment level achieved by the former is sufficient for full restriction.
23408603 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23330719 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23317503 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23305486 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23266279 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23217182 Data indicate tht n the Biaka, strong signal of selection was detected at CUL5 and at TSG101.
23027949 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22768867 The expression of TSG101 in HCC is higher than that in corresponding non-cancer tissues and the expression level is closely correlated with TNM stage and metastasis of HCC.
22761998 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22754649 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22675076 The results provide evidence for a two-step splicing pathway of the TSG101 mRNA in which the initial constitutive splicing removes all 14 authentic splice sites, thereby bringing the weak alternative splice sites into close proximity.
22421880 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22348143 identified TSG101 as a novel FIP4-binding protein, which can also bind FIP3. alpha-helical coiled-coil regions of both TSG101 and FIP4 mediate the interaction with the cognate protein
22291694 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22004035 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21880841 Depletion of endogenous Tsg101 by siRNA led to a significant reduction of HEV release in cultured cells.
21875593 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21841072 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21762798 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21762796 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21666754 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21643473 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21528537 HIV-1 infection affects the expression of host factors TSG101 and Alix
21505419 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21455631 Overexpression of PEG10 and TSG101 was detected in gallbladder adenocarcinoma.
21159863 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21152581 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21117030 TSG101 knockdown in breast cancer cells induces apoptosis and inhibits proliferation. TSG101 may play a biological role through modulation of the MAPK/ERK signaling pathway in breast cancer.
21110817 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21070952 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20712566 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20504928 Taken together, these data indicate that Marburg virus nucleoprotein enhances budding of virus-like particles by recruiting Tsg101 to the VP40-positive budding site through a PSAP late-domain motif.
20427536 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20426868 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20399684 show that ubiquitin recognition by TSG101 is required for cSMAC formation, T cell receptor (TCR) microcluster signal termination, TCR downregulation.
20372822 Results suggest that TSG101 down-regulation in cervical cancer cells is not regulated by genetic or epigenetic events.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20088757 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20018238 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20012524 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19914066 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19802344 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19787439 TSG101 may induce the malignant phenotype of cells.
19692479 Data suggest that HSV-1 production is independent of ALIX and TSG101 expression.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19520058 Ca2+-loaded ALG-2 bridges Alix and TSG101 as an adaptor protein.
19401538 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19362095 molecular dynamics simulations study of the association of the ubiquitin E2 variant domain of the protein Tsg101 and an HIV-derived nonapeptide
19282983 Nucleocapsid region of Gag cooperates with PTAP in the recruitment of cellular proteins necessary for its L domain activity and binds the Bro1-CHMP4 complex required for LYPX(n)L-mediated budding.
19282983 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19244744 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19143627 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19099395 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19064259 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19053244 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19020832 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18976975 siRNA knockdown of TSG101 impairs terminal cleavage of p24/p2 to p24 and HIV release is impaired (from sequential transfection of siRNA followed by plasmid HIVdeltaEnv (pBH10)); HIV release is enhanced by TSG101
18789977 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18676680 Observational study of gene-disease association. (HuGE Navigator)
18600204 Persistent upregulation in colorectal carcinoma cases studied.
18367816 study found that not only the PTAP sequence in the GAT domain but also the PSAP sequence in the C-terminal region of Tom1L1 is responsible for its interaction with the UEV domain of Tsg101 and competes with the HIV-1 Gag protein for the Tsg101 interaction
18367816 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18321968 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18267010 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18077552 Tal polyubiquitinates lysine residues in the C-terminus of uncomplexed Tsg101, resulting in proteasomal degradation.
18005716 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17982468 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17942528 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17940959 Ebola virus can use vacuolar protein surting proteins independently of TSG101 for budding and reveal vacuolar sorting protein 4 as a potential target for filovirus therapeutics.
17853893 that ALIX and TSG101/ESCRT-I also bind a series of proteins involved in cytokinesis, including CEP55, CD2AP, ROCK1, and IQGAP1.
17606716 TSG101 negatively regulates p21 levels, and up-regulation of TSG101 is associated with poor prognosis in ovarian cancer
17556548 study shows that two proteins involved in HIV-1 budding-Tsg101, a subunit of the endosomal sorting complex required for transport I (ESCRT-I), & Alix, an ESCRT-associated protein-were recruited to the midbody during cytokinesis by interaction with Cep55
17556548 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17428861 ALIX can have a dramatic effect on HIV-1 release by binding at the CHMP4B site; the ability to use ALIX may allow HIV-1 to replicate in cells that express only low levels of Tsg101
17369844 the Tsg101 protein has only weak oncogenic properties
17321722 These data suggest that an intracellular calcium store independent PKC-Sp1 signaling pathway induces early keratinocyte differentiation through upregulation of TSG101.
17229889 TSG101 is a specific Mahogunin substrate
17182691 role for TSG101 in the replication of EBV, a DNA virus, that differs from what is observed for RNA viruses, where TSG101 aids mainly in the endosomal sorting of enveloped late viral proteins for assembly at the plasma membrane
17110434 These results demonstrate that TSG101 is important for CITED2- and HIF-1alpha-mediated cellular regulation in ovarian carcinomas.
17083721 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17060450 analysis of mechanism of formation of the principal MDM2 isoforms, differential effects of p53 on the production of these isoforms, and differential abilities of human MDM2 isoforms as regulators of the MDM2/TSG101 and p53/MDM2 feedback control loops
17014699 Four proteins (TSG101,Hrs,Aip1/Alix, and Vps4B) of the ESCRT (endosomal sorting complex required for transport) machinery were localized in T cells and macrophages by quantitative electron microscopy.
16940516 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16808324 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16707569 These results indicate that Tsg101 is required for the formation of stable vacuolar domains within the early endosome that develop into multivesicular body (MVBs) and Hrs is required for the accumulation of internal vesicles within MVBs.
16571793 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16552148 The crystal structure of the TSG101 UEV domain (TSG101-UEV) is presented.
16470130 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16407257 the ORF3 protein exploits the endosomal sorting machinery to enhance the secretion of an immunosuppressant molecule (alpha1 microglobulin) from cultured hepatocytes
16256744 The Tsg101 proteins function in endosomal sorting and are required to incorporate late endosomes into multivesicular bodies.
16234236 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16138902 Data suggest that RSV and HIV-1 Gag direct particle release through independent ESCRT-mediated pathways that are linked through Tsg101-Nedd4 interaction.
16138902 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16004603 The expression and transport of ALG-2 in association with TSG101 and Vps4B are reported.
15908698 interaction of Gag with Tsg101 and Alix favors budding from the plasma membrane and relieves a requirement for ubiquitination by Nedd4
15795524 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
15657031 TSG101 binds GR and protects the non-phosphorylated receptor from degradation.
15256501 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
15218037 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
15168195 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
15126635 Tsg101 and Nedd4.1 act successively in the assembly process of HTLV-1 to ensure proper Gag trafficking through the endocytic pathway up to late endosomes where the late steps of retroviral release occur.
15053872 X-ray crystallography study of the UEV domain of TSG101 and ubquitin showed the basis for the binding recognition at high resolution.
15033475 molecular interactions between Daxx and TSG101 establish an efficient repressive transcription complex in the nucleus
14991575 Reduction of TSG101 protein has a negative impact on breast and prostate tumor cell growth
14761944 TSG101 activates androgen receptor-induced transcription by transient stabilization of the monoubiquitinated state
14581576 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
14526201 alternative splicing and role implicated in interaction with HIV-1
14519844 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
14505570 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
14505569 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12915533 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12900394 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12802020 the TSG101 interaction with HRS is a crucial step in endocytic down-regulation of mitogenic signaling and this interaction may have a role in linking the functions of early and late endosomes
12743307 truncated and full length forms of TSG101 inhibit HIV-1 budding by interacting with the p6 L domain and by disrupting the cellular endosomal sorting machinery
12743307 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12725919 Human ortholog TSG101 does not substitute VPS23 in its ability to rescue the phenotype of defective plasma membrane proteins
12663786 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12598123 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12505256 Analysis of BRCA1, TP53, and TSG101 germline mutations in German breast and/or ovarian cancer families.
12388682 interacts specifically with human immunodeficiency virus type 2 gag polyprotein, results in increased levels of ubiquinated gag, and is incorporated into HIV-2 virions
12388682 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12379843 solution structure of the UEV (ubiquitin E2 variant) binding domain of Tsg101 in complex with a PTAP peptide that spans the late domain of HIV-1 p6(Gag)
12379843 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12006492 structure and functional interactions of its binding sites
12006492 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
11943869 Negative regulation of cell growth and differentiation by TSG101 through association with p21(Cip1/WAF1).
11916981 recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates.
11838966 TSG101 expression in gynecological tumors: relationship to cyclin D1, cyclin E, p53 and p16 proteins.
11805336 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
11726971 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
11595185 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
11427703 HIV-1 Nef induces release of TSG101 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNI      1 - 70
PICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPP     71 - 140
VFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPV    141 - 210
TTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE    211 - 280
VAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALR    281 - 350
RGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY                                  351 - 390
//

Text Mined References (156)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26608825 2015 TSG101, a tumor susceptibility gene, bidirectionally modulates cell invasion through regulating MMP-9 mRNA expression.
26537625 2015 TSG101 Silencing Suppresses Hepatocellular Carcinoma Cell Growth by Inducing Cell Cycle Arrest and Autophagic Cell Death.
26457367 2015 Replacement of the hepatitis E virus ORF3 protein PxxP motif with heterologous late domain motifs affects virus release via interaction with TSG101.
26400331 2015 Gene and protein expression in the oxaliplatin-resistant HT29/L-OHP human colon cancer cell line.
26066081 2015 WASH and Tsg101/ALIX-dependent diversion of stress-internalized EGFR from the canonical endocytic pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25510868 2015 Functional Interaction Between the ESCRT-I Component TSG101 and the HSV-1 Tegument Ubiquitin Specific Protease.
25416956 2014 A proteome-scale map of the human interactome network.
25330247 2014 Interaction with Tsg101 is necessary for the efficient transport and release of nucleocapsids in marburg virus-infected cells.
25010273 2014 Human papillomavirus infection requires the TSG101 component of the ESCRT machinery.
24522922 2014 A host-oriented inhibitor of Junin Argentine hemorrhagic fever virus egress.
24244542 2013 Identification of TSG101 functional domains and p21 loci required for TSG101-mediated p21 gene regulation.
24237697 2013 Type I interferon imposes a TSG101/ISG15 checkpoint at the Golgi for glycoprotein trafficking during influenza virus infection.
24105262 2013 Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles.
23933150 2013 RAB7 and TSG101 are required for the constitutive recycling of unliganded EGFRs via distinct mechanisms.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23408603 2013 Roles played by capsid-dependent induction of membrane curvature and Gag-ESCRT interactions in tetherin recruitment to HIV-1 assembly sites.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23217182 2012 Evidence for selection at HIV host susceptibility genes in a West Central African human population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092844 2013 Monitoring the Rab27 associated exosome pathway using nanoparticle tracking analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22768867 2012 [Expression and significance of tumor susceptibility gene 101 in hepatocellular carcinoma tissues].
22675076 2012 Re-splicing of mature mRNA in cancer cells promotes activation of distant weak alternative splice sites.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22348143 2012 Tumor susceptibility gene 101 (TSG101) is a novel binding-partner for the class II Rab11-FIPs.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21880841 2011 Tumour susceptibility gene 101 and the vacuolar protein sorting pathway are required for the release of hepatitis E virions.
21757351 2011 UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.
21643473 2011 Elucidation of New Binding Interactions with the Tumor Susceptibility Gene 101 (Tsg101) Protein Using Modified HIV-1 Gag-p6 Derived Peptide Ligands.
21528537 2011 [HIV-1 infection affects the expression of host cell factor TSG101 and Alix].
21455631 2011 Identification of PEG10 and TSG101 as carcinogenesis, progression, and poor-prognosis related biomarkers for gallbladder adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
21117030 2011 Down-regulation of TSG101 by small interfering RNA inhibits the proliferation of breast cancer cells through the MAPK/ERK signal pathway.
21070952 2010 Crystallographic and functional analysis of the ESCRT-I /HIV-1 Gag PTAP interaction.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20504928 2010 Tsg101 is recruited by a late domain of the nucleocapsid protein to support budding of Marburg virus-like particles.
20399684 2010 Essential role of ubiquitin and TSG101 protein in formation and function of the central supramolecular activation cluster.
20372822 2010 Analysis of expression and structure of the TSG101 gene in cervical cancer cells.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20176808 2010 TEX14 interacts with CEP55 to block cell abscission.
19787439 2010 TSG101, identified by screening a cancer cDNA library and soft agar assay, promotes cell proliferation in human lung cancer.
19703557 2009 Abnormal regulation of TSG101 in mice with spongiform neurodegeneration.
19692479 2009 Herpes simplex virus type 1 production requires a functional ESCRT-III complex but is independent of TSG101 and ALIX expression.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19520058 2009 Penta-EF-hand protein ALG-2 functions as a Ca2+-dependent adaptor that bridges Alix and TSG101.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19362095 2009 Configurational entropy in protein-peptide binding: computational study of Tsg101 ubiquitin E2 variant domain with an HIV-derived PTAP nonapeptide.
19282983 2009 The nucleocapsid region of HIV-1 Gag cooperates with the PTAP and LYPXnL late domains to recruit the cellular machinery necessary for viral budding.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19143632 2009 Genetic analysis of ESCRT function in Drosophila: a tumour model for human Tsg101.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18600204 2008 Overexpression of WNT2 and TSG101 genes in colorectal carcinoma.
18367816 2008 Recruitment of Tom1L1/Srcasm to endosomes and the midbody by Tsg101.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
18077552 2008 Regulation of Tsg101 expression by the steadiness box: a role of Tsg101-associated ligase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
17940959 2007 Involvement of vacuolar protein sorting pathway in Ebola virus release independent of TSG101 interaction.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17714434 2007 Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation.
17606716 2007 Up-regulation of tumor susceptibility gene 101 conveys poor prognosis through suppression of p21 expression in ovarian cancer.
17556548 2007 Parallels between cytokinesis and retroviral budding: a role for the ESCRT machinery.
17428861 2007 Potent rescue of human immunodeficiency virus type 1 late domain mutants by ALIX/AIP1 depends on its CHMP4 binding site.
17369844 2007 Tsg101 is upregulated in a subset of invasive human breast cancers and its targeted overexpression in transgenic mice reveals weak oncogenic properties for mammary cancer initiation.
17350572 2007 Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding.
17321722 2007 A PKC-Sp1 signaling pathway induces early differentiation of human keratinocytes through upregulation of TSG101.
17229889 2007 Spongiform neurodegeneration-associated E3 ligase Mahogunin ubiquitylates TSG101 and regulates endosomal trafficking.
17182691 2007 Role of the TSG101 gene in Epstein-Barr virus late gene transcription.
17174262 2007 HD-PTP and Alix share some membrane-traffic related proteins that interact with their Bro1 domains or proline-rich regions.
17110434 2007 Up-regulation of tumor susceptibility gene 101 protein in ovarian carcinomas revealed by proteomics analyses.
17060450 2007 Human MDM2 isoforms translated differentially on constitutive versus p53-regulated transcripts have distinct functions in the p53/MDM2 and TSG101/MDM2 feedback control loops.
17014699 2006 Ultrastructural analysis of ESCRT proteins suggests a role for endosome-associated tubular-vesicular membranes in ESCRT function.
16973552 2006 Human ESCRT-II complex and its role in human immunodeficiency virus type 1 release.
16707569 2006 Distinct roles for Tsg101 and Hrs in multivesicular body formation and inward vesiculation.
16571837 2006 Cellular factors required for Lassa virus budding.
16554368 2006 The ESCRT-III subunit hVps24 is required for degradation but not silencing of the epidermal growth factor receptor.
16552148 2006 Structure of human TSG101 UEV domain.
16501490 2006 Collection, storage, preservation, and normalization of human urinary exosomes for biomarker discovery.
16407257 2006 Enhanced alpha1 microglobulin secretion from Hepatitis E virus ORF3-expressing human hepatoma cells is mediated by the tumor susceptibility gene 101.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16256744 2005 Mutations in erupted, the Drosophila ortholog of mammalian tumor susceptibility gene 101, elicit non-cell-autonomous overgrowth.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16138902 2005 The functionally exchangeable L domains in RSV and HIV-1 Gag direct particle release through pathways linked by Tsg101.
16118794 2005 SIMPLE interacts with NEDD4 and TSG101: evidence for a role in lysosomal sorting and implications for Charcot-Marie-Tooth disease.
16004603 2005 The penta-EF-hand protein ALG-2 interacts directly with the ESCRT-I component TSG101, and Ca2+-dependently co-localizes to aberrant endosomes with dominant-negative AAA ATPase SKD1/Vps4B.
15908698 2005 Tsg101 and Alix interact with murine leukemia virus Gag and cooperate with Nedd4 ubiquitin ligases during budding.
15858022 2005 Identification of domains in gag important for prototypic foamy virus egress.
15657031 2005 Stabilization of the unliganded glucocorticoid receptor by TSG101.
15611048 2005 Interactions of TOM1L1 with the multivesicular body sorting machinery.
15509564 2005 Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15256501 2004 Tal, a Tsg101-specific E3 ubiquitin ligase, regulates receptor endocytosis and retrovirus budding.
15240819 2004 The growth-regulatory protein HCRP1/hVps37A is a subunit of mammalian ESCRT-I and mediates receptor down-regulation.
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
15143060 2004 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites.
15126635 2004 Nedd4.1-mediated ubiquitination and subsequent recruitment of Tsg101 ensure HTLV-1 Gag trafficking towards the multivesicular body pathway prior to virus budding.
15053872 2004 Ubiquitin recognition by the human TSG101 protein.
15039775 2004 Interactions of GGA3 with the ubiquitin sorting machinery.
15033475 2004 Physical and functional interactions between Daxx and TSG101.
14991575 2004 Reduction of TSG101 protein has a negative impact on tumor cell growth.
14761944 2004 TSG101 interacts with apoptosis-antagonizing transcription factor and enhances androgen receptor-mediated transcription by promoting its monoubiquitination.
14581576 2003 A bipartite late-budding domain in human immunodeficiency virus type 1.
14581525 2003 PPPYVEPTAP motif is the late domain of human T-cell leukemia virus type 1 Gag and mediates its functional interaction with cellular proteins Nedd4 and Tsg101 [corrected].
14526201 2003 High frequency of alternative splicing of human genes participating in the HIV-1 life cycle: a model using TSG101, betaTrCP, PPIA, INI1, NAF1, and PML.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12927808 2003 Enhanced degradation of MDM2 by a nuclear envelope component, mouse germ cell-less.
12915533 2003 Tsg101 control of human immunodeficiency virus type 1 Gag trafficking and release.
12900395 2003 Hrs regulates multivesicular body formation via ESCRT recruitment to endosomes.
12900394 2003 HIV Gag mimics the Tsg101-recruiting activity of the human Hrs protein.
12802020 2003 TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation.
12743307 2003 Defects in human immunodeficiency virus budding and endosomal sorting induced by TSG101 overexpression.
12725919 2003 Human TSG101 does not replace Saccharomyces cerevisiae VPS23 role in the quality control of plasma membrane proteins.
12663786 2003 Role of ESCRT-I in retroviral budding.
12598123 2003 The HIV-TSG101 interface: recent advances in a budding field.
12559917 2003 Ebola virus matrix protein VP40 interaction with human cellular factors Tsg101 and Nedd4.
12505256 2002 Analysis of BRCA1, TP53, and TSG101 germline mutations in German breast and/or ovarian cancer families.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388682 2002 Tsg101, an inactive homologue of ubiquitin ligase e2, interacts specifically with human immunodeficiency virus type 2 gag polyprotein and results in increased levels of ubiquitinated gag.
12379843 2002 Structure of the Tsg101 UEV domain in complex with the PTAP motif of the HIV-1 p6 protein.
12205095 2002 Targeted deletion of the Tsg101 gene results in cell cycle arrest at G1/S and p53-independent cell death.
12101421 2002 Overexpression of tumor susceptibility gene TSG101 in human papillary thyroid carcinomas.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
12006492 2002 Structure and functional interactions of the Tsg101 UEV domain.
11943869 2002 Negative regulation of cell growth and differentiation by TSG101 through association with p21(Cip1/WAF1).
11916981 2002 Mammalian class E vps proteins recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates.
11838966 2001 TSG101 expression in gynecological tumors: relationship to cyclin D1, cyclin E, p53 and p16 proteins.
11805336 2002 Overexpression of the N-terminal domain of TSG101 inhibits HIV-1 budding by blocking late domain function.
11726971 2001 HIV-1 and Ebola virus encode small peptide motifs that recruit Tsg101 to sites of particle assembly to facilitate egress.
11595185 2001 Tsg101 and the vacuolar protein sorting pathway are essential for HIV-1 budding.
11427703 2001 Tsg101, a homologue of ubiquitin-conjugating (E2) enzymes, binds the L domain in HIV type 1 Pr55(Gag).
11172000 2001 A TSG101/MDM2 regulatory loop modulates MDM2 degradation and MDM2/p53 feedback control.
11134028 2001 TSG101/mammalian VPS23 and mammalian VPS28 interact directly and are recruited to VPS4-induced endosomes.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10888872 2000 DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci.
10508170 1999 Differential regulation of glucocorticoid receptor transcriptional activation via AF-1-associated proteins.
10440698 1999 Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300.
9867424 1998 Retraction. The TSG101 tumor susceptibility gene is located in chromosome 11 band p15 and is mutated in human breast cancer.
9840940 1998 Genomic architecture and transcriptional activation of the mouse and human tumor susceptibility gene TSG101: common types of shorter transcripts are true alternative splice variants.
9465061 1998 Cell cycle-dependent subcellular localization of the TSG101 protein and mitotic and nuclear abnormalities associated with TSG101 deficiency.
9366528 1997 Aberrant splicing of the TSG101 and FHIT genes occurs frequently in multiple malignancies and in normal tissues and mimics alterations previously described in tumours.
9242438 1997 Aberrant splicing but not mutations of TSG101 in human breast cancer.
9241265 1997 Absence of rearrangements in the tumour susceptibility gene TSG101 in human breast cancer.
9241264 1997 TSG101 may be the prototype of a class of dominant negative ubiquitin regulators.
9019400 1997 The TSG101 tumor susceptibility gene is located in chromosome 11 band p15 and is mutated in human breast cancer.