Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.16
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.364 2.7e-04
glioblastoma 1.300 6.4e-05
atypical teratoid / rhabdoid tumor 1.100 4.9e-05
medulloblastoma, large-cell 1.200 4.0e-04
primitive neuroectodermal tumor 1.200 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.2e-02
X-linked cerebral adrenoleukodystrophy 1.200 1.4e-02
Pick disease -1.400 2.6e-05
progressive supranuclear palsy -1.400 8.4e-03
Breast cancer 1.100 7.0e-12
ovarian cancer 1.400 1.8e-03

Gene RIF (2)

PMID Text
24944287 A candidate SNP associated with the tRNA-splicing protein gene TSEN15 was independently associated with the risk of atrial fibrillation.
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL      1 - 70
MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT     71 - 140
LAIVESDSTIVYYKLTDGFMLPDPQNISLRR                                           141 - 171
//

Text Mined References (19)

PMID Year Title
24944287 2014 Genetic variants related to height and risk of atrial fibrillation: the cardiovascular health study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17166513 2007 Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15109492 2004 Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318611 2001 Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus.