Property Summary

NCBI Gene PubMed Count 50
PubMed Score 140.38
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis -1.700 4.4e-08
osteosarcoma 1.759 2.0e-04
atypical teratoid/rhabdoid tumor -1.400 7.8e-06
medulloblastoma, large-cell -1.100 4.2e-03
acute quadriplegic myopathy 1.405 2.3e-06
primary pancreatic ductal adenocarcinoma 1.331 1.9e-02
non-small cell lung cancer -1.245 6.3e-11
intraductal papillary-mucinous carcinoma... -2.200 1.6e-03
X-linked cerebral adrenoleukodystrophy 1.100 2.4e-02
lung cancer -4.300 3.9e-07
colon cancer -2.000 2.0e-02
group 3 medulloblastoma -1.300 2.2e-03
non primary Sjogren syndrome sicca 1.500 3.4e-02
lung adenocarcinoma -2.600 4.1e-14
ductal carcinoma in situ -1.100 7.1e-03
invasive ductal carcinoma -1.100 3.8e-02
ulcerative colitis 2.300 6.0e-04
ovarian cancer -1.500 1.6e-04
chronic rhinosinusitis -1.539 3.2e-02
cystic fibrosis and chronic rhinosinusit... -1.470 3.9e-02
pancreatic cancer 1.300 2.3e-02

Synonym

Accession Q99576 Q5H9S3 Q5JRI9 Q6FIH6 Q8NAI1 Q8WVB9 Q9UBN5 Q9UG13
Symbols DIP
GILZ
DSIPI
TSC-22R

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (35)

PMID Text
26612340 GILZ is a non-redundant regulator of B cell activity, with important potential clinical implications in systemic lupus erythematosus.
26384220 results reveal GILZ to be a new actor in apoptosis regulation in neutrophil-like cells involving JNK and Mcl-1.
25964494 our data suggest that GILZ is a key regulator of macrophage functions.
25168242 L-GILZ stabilizes p53 proteins by decreasing p53 ubiquitination and increasing MDM2 ubiquitination.
24993177 The N-terminal part of L-GILZ protein is responsible for Ras/L-GILZ protein-to-protein interaction, important for the control of proliferation rate of spermatogonia.
24747114 Data show a diminished expression of the anti-inflammatory mediator GILZ in the inflamed vasculature and indicate that GILZ downregulation requires the mRNA binding protein ZFP36.
24215840 PUVA directly stimulates GILZ expression.
23729444 Exogenous GILZ exerts inhibitory effects on endothelial cell adhesive function via a novel pathway involving modulation of NF-kappaB p65 DNA binding and MAPK activity.
23650723 Delta-sleep inducing peptide entrapment and release from polymer hydrogels based on modified polyvinyl alcohol in vitro
23573276 Inhibition of epithelial injury repair by dexamethasone is mediated in part by activation of GILZ.
23494955 study suggests that GILZ variants are not common causes of SCO and NOA in Australian or American men
23440419 DC-SCRIPT serves an important role in regulating GR function in DCs, corepressing GR-dependent upregulation of the tolerance-inducing transcription factor GILZ.
22832853 Glucocorticoid-inducible genes GILZ and SGK-1 might be promising candidate markers for hippocampal volume changes relevant for diseases like MDD.
22539300 The data showed a MyD88- and TTP-dependent GILZ downregulation in human macrophages upon Toll-like receptor activation. Suppression of GILZ is mediated by mRNA destabilization, which might represent a regulatory mechanism in macrophage activation.
22137507 High GILZ mRNA expression was independently associated with increased risk for a high level of posttraumatic stress disorder symptoms.
21804606 these results demonstrate that GILZ is a key inhibitor of the mTORC2 pathway.
21750716 Data show that together with GILZ, chemokine CX3CL1 emerges as a regulator of cell proliferation, which may be of potential clinical relevance for the selection of the most appropriate treatment for EOC patients.
21556028 The glucocorticoid-induced leucine zipper protein GILZ is a glucocorticoid-responsive molecule with signal transduction interactions, many of which are operative in inflammatory diseases; it could be a key endogenous regulator of the immune response.
21512757 UL14 of herpes simplex virus type 1 interacts with cellular factor TSC22D3 during replication.
20970683 Taking into account the unique role of DCs within the allo-HSCT context, novel preventive and curative therapeutics for GVHD might be based on the selective induction of GILZ expression in vivo
20947508 GILZ1 inhibits SGK1 ubiquitinylation and subsequent proteasome-mediated degradation, thereby prolonging its half-life and increasing its steady-state expression.
20018851 GILZ expression provokes a Crm-1-dependent nuclear exclusion of FOXO3 leading to its relocalization to the cytoplasm.
19875485 Implication of the transcription factor GILZ in the pathophysiology of glucocorticoid-induced osteoporosis by regulating osteoblast maturation and bone turnover.
19814803 GILZ activates AKT, a crucial signaling molecule in tumorigenesis appearing as a potential key molecule in epithelial ovarian cancer.
19380724 GILZ1 and SGK1 provide a physical and functional link between the PI3K- and Raf-1-dependent signaling modules
19260870 Down-regulated expression of GILZ may contribute to the pathogenesis of CRSsNP and CRSwNP and associate with response to surgery. GILZ expression in the upper airways can be regulated differentially by different cytokines.
18499442 GILZ is a mediator of glucocorticoid killing, and is regulated by PI3-kinase/AKT.
18468809 Lower basal plasma cortisol levels and a lower expression of corticosteroid receptors and GILZ in fibromyalgia patients when compared to healthy controls.
17956870 multiple GILZ isoforms are expressed in most cells and tissues and that these play distinct roles in regulating proliferation and ion transport.
17356131 GILZ is critical for commitment of DCs to differentiate into regulatory DCs and to the generation of antigen-specific Tregs.
16216878 analysis of a novel link between GILZ and regulation of epithelial sodium transport through modulation of ERK signaling
15705665 Overexpression of the Forkhead transcription factor FoxO3 enhances GC-induced gilz mRNA expression.
15031210 GILZ is a transiently expressed protein induced upon IL-2 withdrawal that protects T cells from the onset of apoptosis.
12393603 Glucocorticoids and IL-10 stimulated macrophage production of GILZ, which displayed activities related to anti-inflammatory and immunosuppressive effects.
11688842 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR      1 - 70
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV           71 - 134
//

Text Mined References (56)

PMID Year Title
26612340 2016 Glucocorticoid-induced leucine zipper (GILZ) inhibits B cell activation in systemic lupus erythematosus.
26384220 2016 Glucocorticoid-Induced Leucine Zipper Is Expressed in Human Neutrophils and Promotes Apoptosis through Mcl-1 Down-Regulation.
25964494 2015 Glucocorticoid-induced leucine zipper: a critical factor in macrophage endotoxin tolerance.
25416956 2014 A proteome-scale map of the human interactome network.
25168242 2015 L-GILZ binds p53 and MDM2 and suppresses tumor growth through p53 activation in human cancer cells.
24993177 2014 Recombinant long-glucocorticoid-induced leucine zipper (L-GILZ) protein restores the control of proliferation in gilz KO spermatogonia.
24747114 2014 Downregulation of the glucocorticoid-induced leucine zipper (GILZ) promotes vascular inflammation.
24215840 2014 Activation of GILZ gene by photoactivated 8-methoxypsoralen: potential role of immunoregulatory dendritic cells in extracorporeal photochemotherapy.
23729444 2013 GILZ overexpression inhibits endothelial cell adhesive function through regulation of NF-?B and MAPK activity.
23650723 [Delta-sleep inducing peptide entrapment and release from polymer hydrogels based on modified polyvinyl alcohol in vitro].
23573276 2013 Dexamethasone inhibits repair of human airway epithelial cells mediated by glucocorticoid-induced leucine zipper (GILZ).
23494955 2013 Genetic variants in the human glucocorticoid-induced leucine zipper (GILZ) gene in fertile and infertile men.
23440419 2013 DC-SCRIPT regulates glucocorticoid receptor function and expression of its target GILZ in dendritic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22832853 2012 Reduced expression of glucocorticoid-inducible genes GILZ and SGK-1: high IL-6 levels are associated with reduced hippocampal volumes in major depressive disorder.
22539300 2012 Glucocorticoid-induced leucine zipper is downregulated in human alveolar macrophages upon Toll-like receptor activation.
22137507 2012 Glucocorticoid receptor pathway components predict posttraumatic stress disorder symptom development: a prospective study.
21804606 2012 GILZ inhibits the mTORC2/AKT pathway in BCR-ABL(+) cells.
21750716 2011 Identification of the chemokine CX3CL1 as a new regulator of malignant cell proliferation in epithelial ovarian cancer.
21556028 2011 Role of GILZ in immune regulation, glucocorticoid actions and rheumatoid arthritis.
21512757 2011 Screening and identification of host factors interacting with UL14 of herpes simplex virus 1.
20970683 2010 Role of glucocorticoid-induced leucine zipper (GILZ) expression by dendritic cells in tolerance induction.
20947508 2010 Glucocorticoid-induced Leucine zipper 1 stimulates the epithelial sodium channel by regulating serum- and glucocorticoid-induced kinase 1 stability and subcellular localization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018851 2010 Glucocorticoid-induced leucine zipper (GILZ) promotes the nuclear exclusion of FOXO3 in a Crm1-dependent manner.
19875485 2010 The glucocorticoid-induced leucine zipper gene (GILZ) expression decreases after successful treatment of patients with endogenous Cushing's syndrome and may play a role in glucocorticoid-induced osteoporosis.
19814803 2009 Identification of glucocorticoid-induced leucine zipper as a key regulator of tumor cell proliferation in epithelial ovarian cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19380724 2009 Epithelial sodium channel regulated by differential composition of a signaling complex.
19260870 2009 Chronic rhinosinusitis with and without nasal polyps is associated with decreased expression of glucocorticoid-induced leucine zipper.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18499442 2008 Dual regulation of glucocorticoid-induced leucine zipper (GILZ) by the glucocorticoid receptor and the PI3-kinase/AKT pathways in multiple myeloma.
18468809 2008 Glucocorticoid sensitivity in fibromyalgia patients: decreased expression of corticosteroid receptors and glucocorticoid-induced leucine zipper.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17956870 2007 Differential activities of glucocorticoid-induced leucine zipper protein isoforms.
17356131 2007 Induction of antigen-specific regulatory T lymphocytes by human dendritic cells expressing the glucocorticoid-induced leucine zipper.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16216878 2005 A novel role for glucocorticoid-induced leucine zipper protein in epithelial sodium channel-mediated sodium transport.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15705665 2005 FoxO3 mediates antagonistic effects of glucocorticoids and interleukin-2 on glucocorticoid-induced leucine zipper expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15031210 2004 GILZ, a new target for the transcription factor FoxO3, protects T lymphocytes from interleukin-2 withdrawal-induced apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12671681 2003 A glucocorticoid-induced leucine-zipper protein, GILZ, inhibits adipogenesis of mesenchymal cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393603 2003 Synthesis of glucocorticoid-induced leucine zipper (GILZ) by macrophages: an anti-inflammatory and immunosuppressive mechanism shared by glucocorticoids and IL-10.
12391160 2002 Glucocorticoid-induced leucine zipper inhibits the Raf-extracellular signal-regulated kinase pathway by binding to Raf-1.
11688842 2001 Human TSC-22 gene: no association with type 2 diabetes.
11468175 2001 Modulation of T-cell activation by the glucocorticoid-induced leucine zipper factor via inhibition of nuclear factor kappaB.
11397794 2001 Inhibition of AP-1 by the glucocorticoid-inducible protein GILZ.
11313722 2001 Cloning, chromosomal assignment and tissue distribution of human GILZ, a glucocorticoid hormone-induced gene.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9110174 1997 Large-scale concatenation cDNA sequencing.
8982256 1996 hDIP--a potential transcriptional regulator related to murine TSC-22 and Drosophila shortsighted (shs)--is expressed in a large number of human tissues.
8619474 1996 A "double adaptor" method for improved shotgun library construction.