Property Summary

NCBI Gene PubMed Count 54
PubMed Score 159.77
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Protein-protein Interaction (6)

Gene RIF (39)

AA Sequence

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR      1 - 70
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV           71 - 134
//

Text Mined References (60)

PMID Year Title