Property Summary

NCBI Gene PubMed Count 32
PubMed Score 41.49
PubTator Score 44.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
22870275 TSC-22 acts as a tumor suppressor by safeguarding p53 from poly-ubiquitination mediated-degradation.
21881999 we report that induced Tsc-22 leads to enhancement of TGF-beta-dependent signaling and enhancement is blocked by expression of a dominant-negative Tsc-22 mutant
21448135 Differential regulation of antagonistic TSC22D1 variants is required for the establishment of oncogene-induced cellular senescence.
20802130 Results support role of TSC22D1 as an enhancer of CNP transcription and suggest that TGF-beta-induced upregulation of CNP expression in smooth muscle may be mediated in part by increased transcription of TSC22D1.
20149264 Long form of TSC22DF is evolutionarily conserved and has growth-regulating potential.
18325344 interaction between fortilin and TSC-22 prevents apoptosis via the destabilization of TSC-22 in ovarian carcinoma cells
18288391 Expression of TSC-22 was frequently observed in the tumor cells with differentiated-phenotypes, although rarely in the cells with growing potentials.
17690703 TSC-22 is a potential tumor suppressor that is upregulated by Flt3-D835V but not Flt3-ITD
17622752 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16106424 expression of TSC-22 in prostate is restricted to basal layer; maybe useful marker for differentation between normal and malignant acinar epithelium of prostate
15881652 Tsc-22 modulates the TGF-beta-dependant signaling pathway and binds to and modulate the transcriptional activity of Smad3 and Smad4. It has effect on cellular differentiation
12767908 Upregulation of TSC-22 mRNA by TGF-beta 1 is achieved by mRNA stabilization.
12757981 Observational study of gene-disease association. (HuGE Navigator)
12757981 findings suggest that the TSC-22 gene (-396) A allele is associated with an increasing risk of diabetic nephropathy
12468551 TSC-22 is an important downstream component of PPARgamma and TGF-beta signaling during intestinal epithelial cell differentiation
11836610 Leucine Zipper structure of TSC22 markedly inhibits the anchorage independent growth of salivary gland cancer cells

AA Sequence

MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPPPSLLQPPPPA      1 - 70
ASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDD     71 - 140
LDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVV    141 - 210
INGNAHPHHLHHHHQIHHGHHLQHGHHHPSHVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAV    211 - 280
SSSGSPASVMTNMRAPSTTGGIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVS    281 - 350
VGPGVTSGVNVNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK    351 - 420
KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHYTESVGSGEMG    421 - 490
APTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSISQSQISQVQLQSQELSYQQKQ    491 - 560
GLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSLAQPQLPYSQAAPPVQTPLPGAPPPQQLQYG    561 - 630
QQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTA    631 - 700
VPAQPAGASVQPVGQAPAAVSAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQT    701 - 770
GIIHQGVQTSAPSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG    771 - 840
PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQSLAQAIGSQI    841 - 910
EDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPLTTPLVDGEDESSSGASVVAI    911 - 980
DNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPA    981 - 1050
TTQPQGTTQPPAQPASQGSGPTA                                                  1051 - 1073
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22870275 2012 Crucial role of TSC-22 in preventing the proteasomal degradation of p53 in cervical cancer.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21881999 2012 Regulation of TGF-? signaling by PKC depends on Tsc-22 inducibility.
21448135 2011 Antagonistic TSC22D1 variants control BRAF(E600)-induced senescence.
21269460 2011 Initial characterization of the human central proteome.
20802130 2010 Transforming growth factor-beta1 regulation of C-type natriuretic peptide expression in human vascular smooth muscle cells: dependence on TSC22D1.
20149264 2010 Madm (Mlf1 adapter molecule) cooperates with Bunched A to promote growth in Drosophila.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18355271 2008 A TSC22-like motif defines a novel antiapoptotic protein family.
18325344 2008 Interaction between fortilin and transforming growth factor-beta stimulated clone-22 (TSC-22) prevents apoptosis via the destabilization of TSC-22.
18288391 2008 Expression and cellular localization of TSC-22 in normal salivary glands and salivary gland tumors: implications for tumor cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17690703 2007 Identification of TSC-22 as a potential tumor suppressor that is upregulated by Flt3-D835V but not Flt3-ITD.
17622752 2007 TGF-beta1 and TSC-22 gene polymorphisms and susceptibility to microvascular complications in type 2 diabetes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16106424 2006 Differential expression of TGFbeta-stimulated clone 22 in normal prostate and prostate cancer.
15881652 2005 Tsc-22 enhances TGF-beta signaling by associating with Smad4 and induces erythroid cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12767908 2003 Posttranscriptional regulation of TSC-22 (TGF-beta-stimulated clone-22) gene by TGF-beta 1.
12757981 2003 The role of the TSC-22 (-396) A/G variant in the development of diabetic nephropathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468551 2003 Peroxisome proliferator-activated receptor gamma and transforming growth factor-beta pathways inhibit intestinal epithelial cell growth by regulating levels of TSC-22.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.
11944908 2002 Cytoplasmic TSC-22 (transforming growth factor-beta-stimulated clone-22) markedly enhances the radiation sensitivity of salivary gland cancer cells.
11095965 2000 Nuclear translocation of TSC-22 (TGF-beta-stimulated clone-22) concomitant with apoptosis: TSC-22 as a putative transcriptional regulator.
10488076 1999 Transforming growth factor-beta-stimulated clone-22 is a member of a family of leucine zipper proteins that can homo- and heterodimerize and has transcriptional repressor activity.
9026990 [The characteristics of different types of mRNA expressed in the human brain].
9022669 1996 Molecular cloning and characterization of a transcription factor for the C-type natriuretic peptide gene promoter.
8651929 1996 Cloning of the human homologue of the TGF beta-stimulated clone 22 gene.
1587811 1992 Isolation of a gene encoding a putative leucine zipper structure that is induced by transforming growth factor beta 1 and other growth factors.