Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.38
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 4.3e-02
Breast cancer 2.600 2.7e-02
breast carcinoma 1.200 3.6e-03
glioblastoma multiforme -1.200 7.8e-24
medulloblastoma, large-cell 1.300 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.182 1.1e-02

Gene RIF (2)

AA Sequence

MAASEAAVVSSPSLKTDTSPVLETAGTVAAMAATPSARAAAAVVAAAARTGSEARVSKAALATKLLSLSG      1 - 70
VFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLT     71 - 140
SMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRL    141 - 210
STLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQ    211 - 280
GPFTLEEHALPEDKWTIDDIAQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKREDDVIKTC     281 - 349
//

Text Mined References (13)

PMID Year Title