Property Summary

NCBI Gene PubMed Count 49
PubMed Score 36.29
PubTator Score 52.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.200 9.7e-07
ependymoma 1.100 2.8e-02
oligodendroglioma 1.100 1.5e-02
osteosarcoma 1.976 1.9e-06
group 4 medulloblastoma 1.800 2.4e-04
astrocytoma 1.600 9.7e-03
atypical teratoid / rhabdoid tumor 1.700 4.6e-05
glioblastoma 1.300 1.6e-02
medulloblastoma, large-cell 1.900 1.5e-06
primitive neuroectodermal tumor 1.100 1.9e-05
adrenocortical carcinoma 1.008 4.5e-03
aldosterone-producing adenoma -1.137 1.9e-02
subependymal giant cell astrocytoma -1.362 1.7e-02
lung adenocarcinoma 1.106 2.4e-07
ovarian cancer 2.500 3.2e-06
Gaucher disease type 1 -1.500 3.5e-02

Gene RIF (19)

PMID Text
25925205 Data suggest that ubiquitin thioesterase 7 (HAUSP) may act as an oncogenic protein that can modulate c-MYC protein expression via transformation-transcription domain-associated protein (TRRAP).
24705139 MYC associates with STAGA through extended interactions of the TAD with both TRRAP and GCN5.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
23362228 Findings establish Trrap as a critical part of the mechanism that restricts differentiation and promotes the maintenance of key features of ESCs.
23318449 TRRAP is targeted for destruction in a cell cycle-dependent fashion.
21499247 TRRAP harbors a recurrent mutation that clustered in one position (p. Ser722Phe) in 6 out of 167 melanoma samples (approx. 4%). The nature, pattern and functional evaluation of the TRRAP recurrent mutation suggest that TRRAP functions as an oncogene.
20943076 The over-expression of TRA1 in hepatocirrhosis and hepatocellular carcinoma is correlated with the formation and development of HCC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20085741 knockdown of the adaptor protein TRRAP significantly increased differentiation of cultured brain tumor-initiating cells, sensitized the cells to apoptotic stimuli, and negatively affected cell cycle progression.
19818711 SKIP recruits c-Myc and TRRAP to the HIV-1 Tat-activated LTR promoter. The c-Myc:TRRAP complex is repressive to HIV-1 transcription under UV stress
19454010 SKIP recruits c-Myc and TRRAP to the HIV-1 Tat-activated LTR promoter. The c-Myc:TRRAP complex is repressive to HIV-1 transcription under UV stress
19066453 Loss of Transduction; transformation-transcription domain-associated protein leads to a reduced level of beta-catenin ubiquitination, accumulation of beta-catenin protein and concomitant hyperactivation of the Wnt Proteins pathway.
17967892 NPAT recruits the TRRAP-Tip60 complex to histone gene promoters to coordinate the transcriptional activation of multiple histone genes during the G(1)/S-phase transition
17694078 Several function of TRRAP during cellular process like: DNA repair, cell cycle, transcription etc...
16341205 HAT cofactor Trrap and Tip60 HAT bind to the chromatin surrounding sites of DNA double-strand breaks (DSBs). Cells may use the same basic mechanism involving HAT complexes to regulate distinct cellular processes, such as transcription and DNA repair.
15647280 Results identify YL1 as a subunit of the TRRAP/TIP60 HAT complex, and also as a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.
12660246 requirement in transcription activation via c-myc transformation domain
12138177 Data suggest a model in which p53 directly recruits a TRRAP/acetyltransferase complex to the mdm2 gene to activate transcription. In addition, this study defines a novel mechanism utilized by the p53 tumor suppressor to regulate gene expression.
12077335 TRRAP binding and the recruitment of histone H3 and H4 acetyltransferase activities are required for the transactivation of a silent TERT gene in exponentially growing human fibroblasts by c-Myc or N-Myc protein.

AA Sequence

MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFL      1 - 70
TFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELH     71 - 140
KQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVPPPEMVGMITTIAVKVNPEREDSETR    141 - 210
THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADF    211 - 280
IAAQIKTLSFLAYIIRIYQELVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPC    281 - 350
MDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC    351 - 420
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAVEAALPGVPTA    421 - 490
PAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQTFQVTDCRSLVKTLVCGVKTI    491 - 560
TWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRVANCQTVRMKEEKE    561 - 630
VLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEM    631 - 700
GSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGG    701 - 770
SHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT    771 - 840
LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQ    841 - 910
KLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDN    911 - 980
KHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQALTGAFMSAVIKDLRPSALPFVASLIRHYT    981 - 1050
MVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFD   1051 - 1120
VASIILGSKERACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFV   1121 - 1190
MMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQA   1191 - 1260
MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQPRLFTMDLNVV   1261 - 1330
EHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNSE   1331 - 1400
LQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQH   1401 - 1470
LRKWMEVVVITHKGGQRSDGNESISECGRCPLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVM   1471 - 1540
KTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNR   1541 - 1610
FITLLLPGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERH   1611 - 1680
RKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKR   1681 - 1750
ALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPEGDNPESITSVFITKVLDPEK   1751 - 1820
QADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRRLMTFAWPCLLSKACVDPACKYSGHLLLAHI   1821 - 1890
IAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQL   1891 - 1960
VHILHLIVQHFKVYYPVRHHLVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDM   1961 - 2030
DPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNF   2031 - 2100
LIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQPNQVNYGNICTG   2101 - 2170
LEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLMSIFPTEPSTSSVASKYEELE   2171 - 2240
CLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAA   2241 - 2310
SGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSP   2311 - 2380
MAANQTPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCA   2381 - 2450
QPLIRAKFFEVFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPS   2451 - 2520
ITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHM   2521 - 2590
LTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHALAGEISPFLCSGS   2591 - 2660
HQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQAFEKGLSLQIKPKQTTE   2661 - 2730
FYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKA   2731 - 2800
KKEHERSNASPAIFPEYQLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALV   2801 - 2870
QVEVSCPKEMAWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQI   2871 - 2940
IELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGKPTWSGMHS   2941 - 3010
SSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIR   3011 - 3080
QQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHD   3081 - 3150
VLVKAWAMWGDYLENIFVKERQLHLGVSAITCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVD   3151 - 3220
KYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGP   3221 - 3290
IRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSD   3291 - 3360
AKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPG   3361 - 3430
SMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFM   3431 - 3500
PRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESRREERVLQLLRLLNPCLEKRKETTKRHLFFT   3501 - 3570
VPRVVAVSPQMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKE   3571 - 3640
VQSNMVPRSMLKEWALHTFPNATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYF   3641 - 3710
RFDINDATGDLDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIA   3711 - 3780
WHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLDNLCR   3781 - 3850
MDPAWHPWL                                                                3851 - 3859
//

Text Mined References (59)

PMID Year Title
25925205 2015 HAUSP regulates c-MYC expression via de-ubiquitination of TRRAP.
24705139 2014 MYC interacts with the human STAGA coactivator complex via multivalent contacts with the GCN5 and TRRAP subunits.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23362228 2013 Histone acetyltransferase cofactor Trrap maintains self-renewal and restricts differentiation of embryonic stem cells.
23318449 2014 The histone acetyltransferase component TRRAP is targeted for destruction during the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21499247 2011 Exome sequencing identifies GRIN2A as frequently mutated in melanoma.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20943076 2010 [Expression and its clinicopathological features of tumor rejective antigen 1 in human tissues of hepatocellular carcinoma and liver cirrhosis].
20427287 2010 Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20085741 2010 An RNAi screen identifies TRRAP as a regulator of brain tumor-initiating cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19066453 2008 HAT cofactor TRRAP mediates beta-catenin ubiquitination on the chromatin and the regulation of the canonical Wnt pathway.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18206972 2008 A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17967892 2008 Transcriptional activation of histone genes requires NPAT-dependent recruitment of TRRAP-Tip60 complex to histone promoters during the G1/S phase transition.
17694078 2007 Orchestration of chromatin-based processes: mind the TRRAP.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
16382133 2006 The transcriptional histone acetyltransferase cofactor TRRAP associates with the MRN repair complex and plays a role in DNA double-strand break repair.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341205 2006 Histone acetylation by Trrap-Tip60 modulates loading of repair proteins and repair of DNA double-strand breaks.
15711126 2005 Rendez-vous at mitosis: TRRAPed in the chromatin.
15649435 2005 TRRAP as a hepatic coactivator of LXR and FXR function.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15115762 2004 Ataxin-7 is a subunit of GCN5 histone acetyltransferase-containing complexes.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12853948 2003 The DNA sequence of human chromosome 7.
12743606 2003 The adenovirus E1A oncoprotein recruits the cellular TRRAP/GCN5 histone acetyltransferase complex.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12660246 2003 c-Myc transformation domain recruits the human STAGA complex and requires TRRAP and GCN5 acetylase activity for transcription activation.
12601814 2003 Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138177 2002 Transcriptional regulation of the mdm2 oncogene by p53 requires TRRAP acetyltransferase complexes.
12077335 2002 TRRAP-dependent and TRRAP-independent transcriptional activation by Myc family oncoproteins.
11839798 2002 BAF53 forms distinct nuclear complexes and functions as a critical c-Myc-interacting nuclear cofactor for oncogenic transformation.
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11509179 2001 The p400 complex is an essential E1A transformation target.
11445536 2001 The ATM-related domain of TRRAP is required for histone acetyltransferase recruitment and Myc-dependent oncogenesis.
11418595 2001 E2F transcriptional activation requires TRRAP and GCN5 cofactors.
11406595 2001 UV-damaged DNA-binding protein in the TFTC complex links DNA damage recognition to nucleosome acetylation.
10966108 2000 Involvement of the TIP60 histone acetylase complex in DNA repair and apoptosis.
10611234 2000 The essential cofactor TRRAP recruits the histone acetyltransferase hGCN5 to c-Myc.
10373431 1999 Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction.
9885574 1998 The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily.
9708738 1998 The novel ATM-related protein TRRAP is an essential cofactor for the c-Myc and E2F oncoproteins.