Property Summary

NCBI Gene PubMed Count 94
PubMed Score 230.18
PubTator Score 184.43

Knowledge Summary

Patent (25,242)

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 1.2e-03
psoriasis -1.400 1.8e-63
atypical teratoid / rhabdoid tumor -1.400 3.8e-06
glioblastoma -1.500 4.3e-05
medulloblastoma, large-cell -1.600 4.1e-05
intraductal papillary-mucinous adenoma (... -1.400 3.5e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.1e-02
adult high grade glioma -1.700 1.8e-04
ovarian cancer -1.200 2.6e-05

Gene RIF (78)

PMID Text
26818094 TRPV6 is down-regulated in esophageal squamous cell carcinoma and plays a role in predicting survival of male and female patients.
26563429 TRPV6 calcium ion channel plays a critical role in flow-induced Ca(2+) influx and microvilli formation.
26449889 our results demonstrate that hCAT-1 is a key component of efficient T-cell activation
26283571 These results suggest that CAT-1 is a novel CAM that directly regulates endothelial integrity and mediates the protective actions of L-Arg to endothelium via a NO-independent mechanism.
25477137 TRPV6 and PLC-delta1 are critical actor of Ca(2+) homeostasis in CF human bronchial epithelial cells.
25372600 focus on TRPV6 gene polymorphisms, the start of TRPV6 translation at a non-AUG codon and the functions of TRPV6 in intestinal Ca(2+) uptake, sperm maturation, and male fertility.
25172921 TRPV6 channel acquires its oncogenic potential in prostate cancer due to the remodeling mechanism via the Orai1-mediated calcium/Annexin I/S100A11 pathway.
25164318 High TRPV6 expression is aassociated with adenoma of parathyroid glands.
24761864 Decreased expression of TRPV6 is associated with non-small cell lung cancer.
24592736 these data showed that TRPV5/TRPV6 in human lymphocytes are functionally active, and their activity is associated with proliferative status of blood cells.
23968883 These results suggest that TRPV5 and TRPV6 are crucial gates controlling cadmium and zinc levels in the human body.
23612980 A non-AUG start codon in used in both human and mouse, extending the N-terminus of the protein by 40 amino acids. The increased translation of the smaller TRPV6 cDNA version may overestimate the in vivo situation where translation efficiency may represent an additional mechanism to tightly control the TRPV6-mediated Ca(2+) entry to prevent deleterious Ca(2+) overload
23373973 Overexpression of miR-122 and concomitant suppression of CAT1 in the primary tumor appears to play important roles in the development of colorectal liver metastasis.
23300090 Ca(2+), CaM, and the depletion of PI(4,5)P(2) all contribute to inactivation of TRPV6
23140583 The interaction of TRPV6 and Numb1 influences TRPV6-mediated Ca2+ influx.
22932896 a functional interaction of TRPC1 with TRPV6 that negatively regulates Ca(2+) influx in HEK293 cells.
22807578 Increased TRPV6 expression is a feature of estrogen receptor (ER)-negative breast tumors.
22589201 Intestinal TRPV6 function in Ca and bone metabolism in wild-type (WT) and vitamin D receptor knockout (VDRKO) mice, was tested.
22378746 Knocking down endogenous OCRL by antisense approach increased TRPV6-mediated Ca(2+) transport and TRPV6 forward trafficking.
22354706 The TRPV6 is a close homolog of TRPV5, yet their calmodulin binding sites display diversity in binding modes, binding stoichiometries and binding affinities which may fine-tune the response of the channels to varying Ca(2+)-concentrations.
22163264 Data show that the transient receptor potential ion channel TRPV6 is expressed only at low levels in osteoblasts and plays little functional role in osteoblastic calcium uptake.
21810903 Our data establish PtdIns(4,5)P(2) as a direct activator of TRPV6 and demonstrate that intracellular ATP regulates the channel indirectly as a substrate for type III PI4Ks
21732366 Data suggest that TRPV6 and other proteins involved in transcellular Ca(2+) transport are dynamically expressed in bone cells, while TRPV6 appears not crucial for bone metabolism and matrix mineralization.
21400627 Immunohistochemical analysis of the distribution of TRPV6 and PMCA1 in the uterus revealed that both proteins are abundantly expressed in the cytoplasm of endometrial and glandular epithelial cells during menstrual phases.
21349844 endogenous TRPV6 channels are activated downstream of a G protein-coupled receptor and present the first physiological characterization of these channels in situ.
21228504 Quercetin aglycon supplementation gives rise to stimulate TRPV6 gene expression in the upper small intestine, which improves calcium absorption from epithelia.
21146870 TRPV6 is not only involved in calcium transport but also in the transport of other divalent cations, including heavy metal ions, which may have toxicological implications.
20948163 allele with 3 derived nonsynonymous SNPs (157C, 378M, 681M) of gene encoding calcium permeable TRPV6 humans having derived-TRPV6 in non-African areas may absorb higher Ca(2)+ from intestine than ancestral-TRPV6 in Africa
20730379 Studies indicate that TRPV6 was present in PCa tissue specimens and in lymph node metastasis, but not in BPH or in normal prostate.
20684323 TRPV6-targeted siRNA can inhibit the transcription of TRPV6, and inhibit proliferation, arrest the cell cycle and induce apoptosis of LNCaP cells.
20405023 Retinal pigment epithelium expresses the epithelial calcium channels TRPV5 and TRPV6, the most calcium-selective channels of the TRP superfamily.
20178461 Data show that TRPV5 and TRPV6 expression is decreased in PE.
20041238 Data conclude that PIKfyve participates in the regulation of TRPV6.
19857260 Although expression of trpv6 transcripts correlates with aggressive potential of prostate cancer, the TRPV6 genotype does not correlate with the onset of prostate cancer.
19857260 Observational study of gene-disease association. (HuGE Navigator)
19779013 Duodenal TRPV6, PMCA1, and CYP24 transcripts respond rapidly to 1,25(OH)(2)D(3). Suggest that local duodenal production of 1,25(OH)(2)D(3) by 25OHD-1alpha-hydroxylase may have a role in human calcium absorption.
19295174 human myeloid leukemia cells coexpress functional TRPV5 and TRPV6 calcium channels that may interact with each other and contribute into intracellular Ca(2+) signaling
19169858 These results further support the idea that the skewed polymorphism of TRPV6 is generated by recent positive selection rather than being the result of demographic events in the Guangzhou population.
19140341 The expression pattern and the selective Ca2+ permeation properties of TRPV6 channel indicate an important role of this channel in the Ca2+ homeostasis and probably in malignant transformation of blood cells.
19056662 Regulation of TRPV6 gene expression by short chain fatty acids may be a molecular mechanism involved in the promotion of calcium absorption by fructooligosaccharides in rats.
18976975 Knockdown of transient receptor potential cation channel, subfamily V, member 6 (TRPV6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18445599 CypB is a new TRPV6 accessory protein with potential involvement in TRPV6 channel activation through its peptidyl-prolyl cis/trans isomerase activity
18395250 Results suggest that TRPV6 channels in T84 cells contribute to the calcium entry/signalling pathway that is sensitive to 17beta-estradiol.
18392847 this study presents the first physiological function of Nipsnap1 as an associated protein inhibiting transient receptor potential vanilloid channel 6 activity that possibly exerts its effect directly at the plasma membrane
18301763 all non-African populations carry a signature of selection on the same haplotype at the TRPV6 locus, demonstrating a widespread parallel selection event acting on standing genetic variation in humans
18276610 The ancestral gain-of-function haplotype in TRPV6 plays a role in calcium stone formation in certain forms of absorptive hypercalciuria.
18276610 Observational study of gene-disease association. (HuGE Navigator)
18245667 TRPV6 may be a novel target for the development of calcium channel inhibitors to treat breast adenocarcinoma expressing TRPV6.
17587679 a cheese whey protein digest increased the calcium uptake by the CHO-hCaT1 cells, human intestinal Caco-2 cells, and in vivo using rats with enteral feeding
17550901 the TRPV6 channel is a key element in Ca(2+)/1,25-dihydroxyvitamin D3-induced differentiation of human keratinocytes
17233615 TRPV5 and TRPV6 are regulated by calbindin-D(28k), klotho and BSPRY (B-box and SPRY-domain-containing protein) at different levels throughout the epithelial cell [review]
17217060 there is growing evidence that transcriptional regulation of TRPV6 in certain tissues undergoing malignant transformation, such as prostate cancer, is linked to cancer progression--{REVIEW}
17197020 We conclude that phosphorylation/dephosphorylation of tyrosines in position 161 and 162 is essential for regulation of Ca2+ influx through TRPV6 Ca2+ channels in HEK293 cells.
17002582 duodenal TRPV6 expression is vitamin D dependent in men, but not in older women, where expression of TRPV6 and VDR are both reduced
16717058 Data suggest that the rate of TRPV6 protein evolution is significantly accelerated in the human lineage and that the TRPV6 haplotype defined by the derived alleles at C157R, M378V and M681T conferred a selective advantage.
16574738 The human transient receptor potential vanilloid type 6 distal promoter contains multiple vitamin D receptor binding sites that mediate activation by 1,25-dihydroxyvitamin D3 in intestinal cells
16564089 Immunohistochemistry of placental villi sections evidenced presence of TRPV5-TRPV6 channels in basal and apical syncytiotrophoblast plasma membranes.
16529812 therefore suggesting that TRPC1 and/or TRPC3 proteins are responsible for the response to alpha-adrenergic stimulation but that TRPC1, TPRC3 and TRPV6 proteins, expressed alone or concomitantly, are not sufficient for SOC formation.
16356545 expression of TRPV6 increases the rate of Ca(2+) dependent cell proliferation which is a prerequisite for its potential role in tumor progression
16210335 Human CAT1 is involved in erythroid hematopoiesis through its role in importing L-arginine, which appears to be essential for the differentiation of red blood cells.
15894168 PTP1B interacts with TRPV6 in vivo and plays a role in TRPV6-mediated calcium influx in HEK293 cells
15647288 a strong functional link between the operation of expressed TRPC channels and endogenous SOC activity.
15582993 the voltage dependence of TRPV6-mediated Ca(2+) influx is of physiological importance since it occurs at cytosolic Ca(2+) buffering and takes place within a physiologically relevant membrane potential range
15192090 the third ANK repeat of TRPV6 is required for functional subunit assembly
15184369 the TRPV6 channel is regulated by calcium
15020691 it is unlikely that CaT1 is a component of native CRAC channels in mast cells
14736889 TRPV6 is a Ca2+-selective TRP channel lined by amino acid side chains rather than main chain carbonyls
14604453 These results suggest that all components, i.e. the store-operated calcium channel (SOCC), endoplasmic reticulum, and mitochondria, somehow contribute to the altered Ca2+ signalling in bipolar disorder.
14534305 native channels responsible for ISOC are different from those for recombinant ITRPV6 and do not appear to be affected if one of their assumed subunits, TRPV6, is up- or down-regulated, suggesting a rather rigid subunit composition in vivo.
12601087 The effects of intracellular Mg(2+) on TRPV6 are partially reminiscent of the gating mechanism of inwardly rectifying K(+) channels and may represent a novel regulatory mechanism for TRPV6 function in vivo.
12584203 the role of CaT1 in generating endogenous store-operated Ca(2+) current (I(SOC)) in the lymph node carcinoma of the prostate (LNCaP) human prostate cancer epithelial cell line
12390878 Our results indicate that the pattern of CaT1 and CaT2 expression correlates with the Ca2+ uptake potential along the differentiation of cultured human trophoblasts isolated from term placenta.
12361955 CaT1 is the channel protein that contributes to T-lymphocyte stores-operated Ca(2+) channels either alone or as a subunit in a heterogeneous channel complex.
12138163 role of TRPV6 as calcium sensor in rat and human cells
12011062 regulatory component that controls activation of both CaT1 and CRAC (Ca(2+) release-activated Ca(2+) channel) channels.
11744752 to characterize ECaC2 in more detail and to compare ites properties with those of Ecac1 to obtain a better understanding of transcellular Ca2+ transport in epithelia
11545681 1,25-Dihydroxyvitamin D3 increases mRNA expression of the CaT1 calcium channel in the Caco-2 intestinal cell line.
11208552 Gene expressed in human duodenum, placenta and pancreas homologous with calcium transporters/channels in other species. Function proposed to be calcium entry channel at apical membrane.

AA Sequence

MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWA      1 - 70
QSRDEQNLLQQKRIWESPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLME     71 - 140
AAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFA    141 - 210
ACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQG    211 - 280
LTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTKKREARQILDQ    281 - 350
TPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTP    351 - 420
KDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLISASGE    421 - 490
VVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEEL    491 - 560
GHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERD    561 - 630
ELWRAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLD    631 - 700
KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI         701 - 765
//

Text Mined References (96)

PMID Year Title
26818094 2016 TRPV6 plays a new role in predicting survival of patients with esophageal squamous cell carcinoma.
26563429 2015 Fluid shear triggers microvilli formation via mechanosensitive activation of TRPV6.
26449889 2016 Induced arginine transport via cationic amino acid transporter-1 is necessary for human T-cell proliferation.
26283571 2015 CAT-1 as a novel CAM stabilizes endothelial integrity and mediates the protective actions of L-Arg via a NO-independent mechanism.
25559186 2015 TRP channel-associated factors are a novel protein family that regulates TRPM8 trafficking and activity.
25477137 2015 The low PLC-?1 expression in cystic fibrosis bronchial epithelial cells induces upregulation of TRPV6 channel activity.
25372600 2014 The transient receptor potential cation channel subfamily V member 6 (TRPV6): genetics, biochemical properties, and functions of exceptional calcium channel proteins.
25172921 2014 TRPV6 calcium channel translocates to the plasma membrane via Orai1-mediated mechanism and controls cancer cell survival.
25164318 2014 First evidence of TRPV5 and TRPV6 channels in human parathyroid glands: possible involvement in neoplastic transformation.
24761864 2014 Expression and prognostic roles of TRPV5 and TRPV6 in non-small cell lung cancer after curative resection.
24592736 2013 [The functional characteristics oF TRPV5 and TRPV6 channels in normal and transformed human blood lymphocytes].
23968883 2013 Human TRPV5 and TRPV6: key players in cadmium and zinc toxicity.
23612980 2013 The in vivo TRPV6 protein starts at a non-AUG triplet, decoded as methionine, upstream of canonical initiation at AUG.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23373973 2013 Effect of miR-122 and its target gene cationic amino acid transporter 1 on colorectal liver metastasis.
23300090 2013 Interplay between calmodulin and phosphatidylinositol 4,5-bisphosphate in Ca2+-induced inactivation of transient receptor potential vanilloid 6 channels.
23140583 2013 Regulation of calcium influx and signaling pathway in cancer cells via TRPV6-Numb1 interaction.
22932896 2012 Canonical transient receptor potential (TRPC) 1 acts as a negative regulator for vanilloid TRPV6-mediated Ca2+ influx.
22807578 2012 Calcium channel TRPV6 as a potential therapeutic target in estrogen receptor-negative breast cancer.
22589201 2012 Villin promoter-mediated transgenic expression of transient receptor potential cation channel, subfamily V, member 6 (TRPV6) increases intestinal calcium absorption in wild-type and vitamin D receptor knockout mice.
22378746 2012 Suppression of intestinal calcium entry channel TRPV6 by OCRL, a lipid phosphatase associated with Lowe syndrome and Dent disease.
22354706 2012 The TRPV5/6 calcium channels contain multiple calmodulin binding sites with differential binding properties.
22331416 2012 The role of the TRPV6 channel in cancer.
22163264 2011 The transient receptor potential ion channel TRPV6 is expressed at low levels in osteoblasts and has little role in osteoblast calcium uptake.
21810903 2011 Intracellular ATP supports TRPV6 activity via lipid kinases and the generation of PtdIns(4,5) P?.
21732366 2012 The transient receptor potential channel TRPV6 is dynamically expressed in bone cells but is not crucial for bone mineralization in mice.
21400627 2011 Coexpression and estrogen-mediated regulation of TRPV6 and PMCA1 in the human endometrium during the menstrual cycle.
21349844 2011 G protein-coupled receptor signaling via Src kinase induces endogenous human transient receptor potential vanilloid type 6 (TRPV6) channel activation.
21290300 2011 TRPV5 and TRPV6 in transcellular Ca(2+) transport: regulation, gene duplication, and polymorphisms in African populations.
21228504 2010 Quercetin enhances VDR activity, leading to stimulation of its target gene expression in Caco-2 cells.
21146870 2011 Heavy metal cations permeate the TRPV6 epithelial cation channel.
20948163 2010 Derived (mutated)-types of TRPV6 channels elicit greater Ca²+ influx into the cells than ancestral-types of TRPV6: evidence from Xenopus oocytes and mammalian cell expression system.
20730379 2010 TRP channels in human prostate.
20684323 2010 [Inhibitory effect of TRPV6 silencing on prostate cancer cell line LNCaP in vitro].
20405023 2010 Expression of transient receptor potential vanilloid channels TRPV5 and TRPV6 in retinal pigment epithelium.
20178461 2011 Alteration of calcium homeostasis in primary preeclamptic syncytiotrophoblasts: effect on calcium exchange in placenta.
20041238 2010 Regulation of the Ca(2+) channel TRPV6 by the kinases SGK1, PKB/Akt, and PIKfyve.
19857260 2009 TRPV6 alleles do not influence prostate cancer progression.
19779013 2009 Human duodenum responses to vitamin D metabolites of TRPV6 and other genes involved in calcium absorption.
19295174 2009 Endogenous expression of TRPV5 and TRPV6 calcium channels in human leukemia K562 cells.
19169858 2009 Sequence analysis of human TRPV6 suggests positive selection outside Africa.
19140341 2008 [TRPV5 and TRPV6 calcium channels in human T cells].
19056662 2009 Short-chain fatty acids induce intestinal transient receptor potential vanilloid type 6 expression in rats and Caco-2 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18445599 2008 The human TRPV6 channel protein is associated with cyclophilin B in human placenta.
18395250 2008 Rapid effects of 17beta-estradiol on epithelial TRPV6 Ca2+ channel in human T84 colonic cells.
18392847 2008 Identification of Nipsnap1 as a novel auxiliary protein inhibiting TRPV6 activity.
18301763 2008 Parallel selection on TRPV6 in human populations.
18276610 2008 Gain-of-function haplotype in the epithelial calcium channel TRPV6 is a risk factor for renal calcium stone formation.
18245667 2008 The role of TRPV6 in breast carcinogenesis.
17587679 2007 Modulation of the intestinal Ca2+ uptake by a cheese whey protein digest.
17550901 2007 TRPV6 is a Ca2+ entry channel essential for Ca2+-induced differentiation of human keratinocytes.
17233615 2007 Concerted action of associated proteins in the regulation of TRPV5 and TRPV6.
17217060 2007 TRPV6.
17197020 2007 Identification of tyrosines in the putative regulatory site of the Ca2+ channel TRPV6.
17002582 2006 Calcium channel TRPV6 expression in human duodenum: different relationships to the vitamin D system and aging in men and women.
16717058 2006 TRPV6 exhibits unusual patterns of polymorphism and divergence in worldwide populations.
16574738 2006 The human transient receptor potential vanilloid type 6 distal promoter contains multiple vitamin D receptor binding sites that mediate activation by 1,25-dihydroxyvitamin D3 in intestinal cells.
16564089 Diverse calcium channel types are present in the human placental syncytiotrophoblast basal membrane.
16529812 2006 Calcium store contents control the expression of TRPC1, TRPC3 and TRPV6 proteins in LNCaP prostate cancer cell line.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16356545 2006 TRPV6 potentiates calcium-dependent cell proliferation.
16210335 2006 L-arginine import via cationic amino acid transporter CAT1 is essential for both differentiation and proliferation of erythrocytes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15894168 2005 Tyrosine phosphatase PTP1B interacts with TRPV6 in vivo and plays a role in TRPV6-mediated calcium influx in HEK293 cells.
15647288 2005 A functional link between store-operated and TRPC channels revealed by the 3,5-bis(trifluoromethyl)pyrazole derivative, BTP2.
15582993 2005 Voltage-dependent changes of TRPV6-mediated Ca2+ currents.
15192090 2004 Ca2+-selective transient receptor potential V channel architecture and function require a specific ankyrin repeat.
15184369 2004 Ca2+ dependence of the Ca2+-selective TRPV6 channel.
15020691 2004 CaT1 knock-down strategies fail to affect CRAC channels in mucosal-type mast cells.
14736889 2004 Outer pore architecture of a Ca2+-selective TRP channel.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604453 2003 Mechanisms of altered Ca2+ signalling in transformed lymphoblastoid cells from patients with bipolar disorder.
14534305 2003 Store-operated Ca2+ current and TRPV6 channels in lymph node prostate cancer cells.
12869611 2003 Epithelial Ca2+ entry channels: transcellular Ca2+ transport and beyond.
12765698 Role and regulation of TRP channels in neutrophil granulocytes.
12765696 The TRPV6 gene, cDNA and protein.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12660155 2003 Functional expression of the epithelial Ca(2+) channels (TRPV5 and TRPV6) requires association of the S100A10-annexin 2 complex.
12601087 2003 Mg2+-dependent gating and strong inward rectification of the cation channel TRPV6.
12584203 2003 Store-operated Ca2+ current in prostate cancer epithelial cells. Role of endogenous Ca2+ transporter type 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12390878 2002 Expression of calcium channels along the differentiation of cultured trophoblast cells from human term placenta.
12361955 2002 CaT1 contributes to the stores-operated calcium current in Jurkat T-lymphocytes.
12138163 2002 The recombinant human TRPV6 channel functions as Ca2+ sensor in human embryonic kidney and rat basophilic leukemia cells.
12011062 2002 Store depletion-activated CaT1 currents in rat basophilic leukemia mast cells are inhibited by 2-aminoethoxydiphenyl borate. Evidence for a regulatory component that controls activation of both CaT1 and CRAC (Ca(2+) release-activated Ca(2+) channel) channels.
11846401 2002 A single amino acid mutation results in a rapid inactivation of epithelial calcium channels.
11744752 2001 Function and expression of the epithelial Ca(2+) channel family: comparison of mammalian ECaC1 and 2.
11719848 2001 Single-channel activities of the human epithelial Ca2+ transport proteins CaT1 and CaT2.
11549322 2001 Structural conservation of the genes encoding CaT1, CaT2, and related cation channels.
11545681 2001 1,25-Dihydroxyvitamin D3 increases the expression of the CaT1 epithelial calcium channel in the Caco-2 human intestinal cell line.
11401523 2001 CaT1 expression correlates with tumor grade in prostate cancer.
11278579 2001 Expression of CaT-like, a novel calcium-selective channel, correlates with the malignancy of prostate cancer.
11248124 2001 Competitive regulation of CaT-like-mediated Ca2+ entry by protein kinase C and calmodulin.
11208552 2001 Epithelial calcium transporter expression in human duodenum.
11097838 2000 Human calcium transport protein CaT1.