Property Summary

Ligand Count 1
NCBI Gene PubMed Count 59
PubMed Score 139.27
PubTator Score 102.85

Knowledge Summary

Patent (15,528)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 1.2e-03

Gene RIF (41)

AA Sequence

MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTC      1 - 70
DVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRR     71 - 140
ASVSARATGTAFRRSPRNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKT    141 - 210
FACQMYNLLLSYDGHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDL    211 - 280
TEIDSWGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYR    281 - 350
PLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI    351 - 420
LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDL    421 - 490
MRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNF    491 - 560
AFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERKLPRCLWPRSGICGCEFGLGDRWF    561 - 630
LRVENHNDQNPLRVLRYVEVFKNSDKEDDQEHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRG    631 - 700
WEILRQNTLGHLNLGLNLSEGDGEEVYHF                                             701 - 729
//

Text Mined References (62)

PMID Year Title