Property Summary

NCBI Gene PubMed Count 58
PubMed Score 127.08
PubTator Score 102.85

Knowledge Summary

Patent (15,528)

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 1.2e-03

Gene RIF (40)

PMID Text
26837804 These findings indicate that the A563T variation induces structural, dynamical, and electrostatic changes in the TRPV5 pore, providing structural insight into the functional alterations associated with the A563T variation.
26089600 Data found that a TRPV5 polymorphism (rs4236480) was observed to be associated with stone multiplicity of calcium nephrolithiasis, as the risk of stone multiplicity was higher in patients with the TT+CT genotype than in patients with the CC genotype
25378396 Klotho up-regulates TRPV5 from both the inside and outside of cells.
25164318 High TRPV5 expression is aassociated with adenoma of parathyroid glands.
25139832 Upregulating the expression of TRPV5 can be utilized to manipulate transmembrane Ca2+ transport, and may serve as an alternative for the treatment of Ca2+ balance-related diseases.
24761864 Decreased expression of TRPV5 is associated with non-small cell lung cancer.
24592736 these data showed that TRPV5/TRPV6 in human lymphocytes are functionally active, and their activity is associated with proliferative status of blood cells.
23970553 Data indicate that transient receptor potential vanilloid type 5 (TRPV5) plasma membrane retention is regulated via lipid rafts.
23968883 These results suggest that TRPV5 and TRPV6 are crucial gates controlling cadmium and zinc levels in the human body.
23469151 TRPML3 and TRPV5 heteromers could have a biological function
23024298 urinary plasmin could contribute to the downstream effects of proteinuria on the tubulointerstitium by negatively modulating TRPV5
22354706 The TRPV6 is a close homolog of TRPV5, yet their calmodulin binding sites display diversity in binding modes, binding stoichiometries and binding affinities which may fine-tune the response of the channels to varying Ca(2+)-concentrations.
21952826 apically secreted tissue transglutaminase functions as an inhibitor of TRPV5 and thereby contributes to the regulation of body Ca2+ homeostasis.
21576356 Data show that calmodulin negatively modulates TRPV5 activity, which is reversed by parathyroid hormone-mediated channel phosphorylation.
21187068 WNK4 and NHERF2 synergistically regulate TRPV5 by enhancing its forward trafficking and increasing its stability at plasma membrane, respectively.
21063097 G(2)/M cell cycle arrest was preceded by activation of TRPV5/6-like nonselective cation channels in the plasma membrane resulting in an elevated Ca(2+) entry as evident from fura-2 Ca(2+) imaging.
21035851 TRPV5 channel is susceptible for helix breaking mutations and the proximal intracellular region of TM5 of this channel plays an important role in Ca(2+)-dependent inactivation
20686800 A calmodulin binding site was located in the C-termini of TRPV2 (654-683) and TRPV5 (587-616).
20547482 Findings suggest that TRPV-5 contributes to maintaining the homeostasis of the human skeleton via a negative feedback loop in RANKL-induced bone resorption.
20405023 Retinal pigment epithelium expresses the epithelial calcium channels TRPV5 and TRPV6, the most calcium-selective channels of the TRP superfamily.
20178461 Data show that TRPV5 and TRPV6 expression is decreased in PE.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19423690 Parathyroid hormone activates the cAMP-PKA signaling cascade, which rapidly phosphorylates threonine-709 of TRPV5, increasing the channel's open probability and promoting Ca(2+) reabsorption in the distal nephron.
19295174 human myeloid leukemia cells coexpress functional TRPV5 and TRPV6 calcium channels that may interact with each other and contribute into intracellular Ca(2+) signaling
19261737 the A563T variation in TRPV5 may contribute to the superior ability of renal Ca(2+) conservation in African Americans
19157541 Activation of the CaR stimulates TRPV5-mediated Ca(2+) influx via a PMA-insensitive PKC isoform pathway.
19140341 The expression pattern and the selective Ca2+ permeation properties of TRPV5 channel indicate an important role of this channel in the Ca2+ homeostasis.
19131347 Genotyping TRPV5 in renal hypercalciuria revealed three non-synonymous and five synonymous polymorphisms. Electrophysiological study of the TRPV5 mutants did not reveal significant functional changes compared to wild-type TRPV5 channel recordings.
18703016 This study was aimed at the mechanism underlying the difference in the effects of WNK4 on TRPV5 and TRPV6 through analyzing the difference in TRPV5 and TRPV6 expression in the plasma membrane.
18596722 review covers the distinctive properties and regulation of the highly Ca(2+)-selective TRPV5 channel and highlights the implications for our understanding of the process of Ca(2+) reabsorption.
18305097 activation of protein kinase C increases cell surface abundance of TRPV5 by inhibiting endocytosis
18077461 malin ubiquitinates PTG in a laforin-dependent manner, both in vivo and in vitro, and targets PTG for proteasome-dependent degradation. These results suggest an additional mechanism, involving laforin and malin, in regulating glycogen metabolism
17233615 TRPV5 and TRPV6 are regulated by calbindin-D(28k), klotho and BSPRY (B-box and SPRY-domain-containing protein) at different levels throughout the epithelial cell [review]
17217059 TRPV5 is involved in regulation and function in renal Ca2+ reabsorption and overall Ca2+ homeostasis--{review}
17018846 WNK4 positively regulates TRPV5-mediated Ca transport & inhibitory effect of thiazide-sensitive Na+Cl- cotransporter on this process may be involved in pathogenesis of hypercalciuria of familial hyperkalemic hypertension caused by gene mutation in WNK4.
16564089 Immunohistochemistry of placental villi sections evidenced presence of TRPV5-TRPV6 channels in basal and apical syncytiotrophoblast plasma membranes.
16291808 The epithelial Ca2+ channel TRPV5 is essential for proper osteoclastic bone resorption.
12390878 Our results indicate that the pattern of CaT1 and CaT2 expression correlates with the Ca2+ uptake potential along the differentiation of cultured human trophoblasts isolated from term placenta
12198212 does not play a primary role in autosomal dominant hypercalciuria
11765215 Functional properties of the epithelial Ca2+ channel, ECaC.

AA Sequence

MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTC      1 - 70
DVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRR     71 - 140
ASVSARATGTAFRRSPRNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKT    141 - 210
FACQMYNLLLSYDGHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDL    211 - 280
TEIDSWGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYR    281 - 350
PLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI    351 - 420
LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDL    421 - 490
MRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNF    491 - 560
AFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERKLPRCLWPRSGICGCEFGLGDRWF    561 - 630
LRVENHNDQNPLRVLRYVEVFKNSDKEDDQEHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRG    631 - 700
WEILRQNTLGHLNLGLNLSEGDGEEVYHF                                             701 - 729
//

Text Mined References (61)

PMID Year Title
26837804 2016 Molecular Modeling of the Structural and Dynamical Changes in Calcium Channel TRPV5 Induced by the African-Specific A563T Variation.
26089600 2015 A Single Nucleotide Polymorphism (rs4236480) in TRPV5 Calcium Channel Gene Is Associated with Stone Multiplicity in Calcium Nephrolithiasis Patients.
25378396 2014 Klotho up-regulates renal calcium channel transient receptor potential vanilloid 5 (TRPV5) by intra- and extracellular N-glycosylation-dependent mechanisms.
25164318 2014 First evidence of TRPV5 and TRPV6 channels in human parathyroid glands: possible involvement in neoplastic transformation.
25139832 2014 Induction of TRPV5 expression by small activating RNA targeting gene promoter as a novel approach to regulate cellular calcium transportation.
24761864 2014 Expression and prognostic roles of TRPV5 and TRPV6 in non-small cell lung cancer after curative resection.
24592736 2013 [The functional characteristics oF TRPV5 and TRPV6 channels in normal and transformed human blood lymphocytes].
23970553 2013 The epithelial calcium channel TRPV5 is regulated differentially by klotho and sialidase.
23968883 2013 Human TRPV5 and TRPV6: key players in cadmium and zinc toxicity.
23469151 2013 A novel ion channel formed by interaction of TRPML3 with TRPV5.
23024298 2012 Urinary plasmin inhibits TRPV5 in nephrotic-range proteinuria.
22354706 2012 The TRPV5/6 calcium channels contain multiple calmodulin binding sites with differential binding properties.
21952826 2012 Tissue transglutaminase inhibits the TRPV5-dependent calcium transport in an N-glycosylation-dependent manner.
21576356 2011 Molecular mechanisms of calmodulin action on TRPV5 and modulation by parathyroid hormone.
21187068 2011 Concerted actions of NHERF2 and WNK4 in regulating TRPV5.
21063097 2010 Non-selective cation channel-mediated Ca2+-entry and activation of Ca2+/calmodulin-dependent kinase II contribute to G2/M cell cycle arrest and survival of irradiated leukemia cells.
21035851 2010 A helix-breaking mutation in the epithelial Ca(2+) channel TRPV5 leads to reduced Ca(2+)-dependent inactivation.
20686800 2011 Characterization of calmodulin binding domains in TRPV2 and TRPV5 C-tails.
20547482 2010 TRPV-5 mediates a receptor activator of NF-kappaB (RANK) ligand-induced increase in cytosolic Ca2+ in human osteoclasts and down-regulates bone resorption.
20405023 2010 Expression of transient receptor potential vanilloid channels TRPV5 and TRPV6 in retinal pigment epithelium.
20178461 2011 Alteration of calcium homeostasis in primary preeclamptic syncytiotrophoblasts: effect on calcium exchange in placenta.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19423690 2009 Parathyroid hormone activates TRPV5 via PKA-dependent phosphorylation.
19295174 2009 Endogenous expression of TRPV5 and TRPV6 calcium channels in human leukemia K562 cells.
19261737 2009 The A563T variation of the renal epithelial calcium channel TRPV5 among African Americans enhances calcium influx.
19157541 2009 Activation of the Ca2+-sensing receptor stimulates the activity of the epithelial Ca2+ channel TRPV5.
19140341 2008 [TRPV5 and TRPV6 calcium channels in human T cells].
19131347 2009 TRPV5 gene polymorphisms in renal hypercalciuria.
18768590 2008 WNK3 positively regulates epithelial calcium channels TRPV5 and TRPV6 via a kinase-dependent pathway.
18703016 2008 WNK4 regulates the secretory pathway via which TRPV5 is targeted to the plasma membrane.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18596722 2008 TRPV5: an ingeniously controlled calcium channel.
18305097 2008 Protein kinase C inhibits caveolae-mediated endocytosis of TRPV5.
18077461 2008 TRPV5 is internalized via clathrin-dependent endocytosis to enter a Ca2+-controlled recycling pathway.
17233615 2007 Concerted action of associated proteins in the regulation of TRPV5 and TRPV6.
17217059 2007 TRPV5, the gateway to Ca2+ homeostasis.
17018846 2007 WNK4 enhances TRPV5-mediated calcium transport: potential role in hypercalciuria of familial hyperkalemic hypertension caused by gene mutation of WNK4.
16763551 2006 Calbindin-D28K dynamically controls TRPV5-mediated Ca2+ transport.
16564089 Diverse calcium channel types are present in the human placental syncytiotrophoblast basal membrane.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16291808 2005 The epithelial Ca2+ channel TRPV5 is essential for proper osteoclastic bone resorption.
16239475 2005 The beta-glucuronidase klotho hydrolyzes and activates the TRPV5 channel.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16044309 2005 TRPV5 and TRPV6 in Ca(2+) (re)absorption: regulating Ca(2+) entry at the gate.
15665527 2005 Requirement of PDZ domains for the stimulation of the epithelial Ca2+ channel TRPV5 by the NHE regulating factor NHERF2 and the serum and glucocorticoid inducible kinase SGK1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489237 2004 Molecular determinants in TRPV5 channel assembly.
12853948 2003 The DNA sequence of human chromosome 7.
12765698 Role and regulation of TRP channels in neutrophil granulocytes.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12660155 2003 Functional expression of the epithelial Ca(2+) channels (TRPV5 and TRPV6) requires association of the S100A10-annexin 2 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12390878 2002 Expression of calcium channels along the differentiation of cultured trophoblast cells from human term placenta.
12198212 2002 Epithelial Ca(2+) channel (ECAC1) in autosomal dominant idiopathic hypercalciuria.
12093812 2002 Molecular determinants of permeation through the cation channel TRPV4.
12077606 2002 TRPV3 is a temperature-sensitive vanilloid receptor-like protein.
11846401 2002 A single amino acid mutation results in a rapid inactivation of epithelial calcium channels.
11719848 2001 Single-channel activities of the human epithelial Ca2+ transport proteins CaT1 and CaT2.
11549322 2001 Structural conservation of the genes encoding CaT1, CaT2, and related cation channels.
10945469 2000 Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2+ channel (ECAC1).
10944439 2000 Gene structure and chromosomal mapping of human epithelial calcium channel.