Property Summary

NCBI Gene PubMed Count 45
PubMed Score 186.14
PubTator Score 83.28

Knowledge Summary

Patent (49,966)

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis 1.012 4.8e-05
gastric cancer -1.100 4.8e-02
pancreatic cancer -1.200 3.8e-02
malignant mesothelioma 1.300 6.0e-05
osteosarcoma -1.001 1.9e-02
cystic fibrosis 1.168 1.6e-05
tuberculosis 1.300 2.1e-05
non-small cell lung cancer -1.685 6.3e-18
intraductal papillary-mucinous carcinoma... -1.400 4.7e-04
pancreatic carcinoma -1.200 3.8e-02
lung adenocarcinoma -1.500 1.3e-08
inflammatory breast cancer 1.100 2.6e-02
lung carcinoma -1.600 1.2e-18

 CSPA Cell Line (1)

Gene RIF (34)

PMID Text
26416880 transient receptor potential vanilloid 2 is an intracellular Ca(2+)-permeable transient receptor potential vanilloid channel upregulated by nerve growth factor via the mitogen-activated protein kinase signaling pathway to augment neurite outgrowth.
25869297 This study evaluated the role of Trpv2 in arthritis and the pharmacological effects of Trpv2 agonists.
25641129 There appears to be TRPV1- or TRPV2-IR sympathetic pathway in the human stellate ganglion and spinal cord.
25333484 Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4
25268680 Data indicate that transient receptor potential vanilloid 2 (TRPV2) siRNA virtually abolished stretch-activated current.
25001513 Aim of this review is to study the role of the TRPV2 channel, a member of the TRPV subfamily of TRP channels, in tumor progression. [review]
24878697 High expression of TRPV2 mRNA was closely associated with advanced pathological stage and worse survival of patients with esophageal squamous cell carcinoma.
24764033 TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve
24475260 An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca(2) rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria.
23964684 The addition of TRPV2 inhibitor Tranilast in the incubation medium prevent the calcium influx triggered by lysoPC and reduced lysoPC-induced cytotoxicity,whereas TRPV4 inhibitor RN 1734 was without effect
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of transient receptor potential cation channel V, member 2 (TRPV2) expression by HIV-1 Vpr in Vpr transduced macrophages
23786999 Sarcolemmal TRPV2 accumulation appears to have considerable pathological impact on Dilated cardiomyopathy (DCM) progression.
23741410 TRPV2 mediates adrenomedullin stimulation of prostate and urothelial cancer cell adhesion, migration and invasion.
23542034 TRPV2-coupled signaling as a key player in mediating the cellular actions of heat shock on DCs
23453732 TRPV1 and TRPV2 are potential targets for potential therapeutic interventions in cardiovascular disease.
23426965 Duchenne muscular dystrophy primary human myotubes exhibit abnormal elevation of TRPV2-dependant cation entry.
23294145 The increased expression of TRPV2 gene in peripheral lymphocytes is closely correlated with childhood asthma in the north of China.
22327830 Cultivated HCjE cells and human conjunctiva express TRPV2, mRNA.
21574765 TRPV2 plays a key role in mast-cell degranulation in response to mechanical, heat and red laser-light stimulation.
21506114 Human corneal epithelial cells possess thermosensitive TRPV2 activity.
20926660 Decrease in membrane phosphatidylinositol 4,5-bisphosphate (PIP2) levels on channel activation underlies a major component of divalent calcium ion-dependent desensitization of TRPV2 and may play a similar role in other TRP channels.
20686800 A calmodulin binding site was located in the C-termini of TRPV2 (654-683) and TRPV5 (587-616).
20113837 TRPV2 plays a role in human hepatocarcinogenesis and might be a prognostic marker of patients with hepatocellular carcinoma (HCC).
20103638 Findings establish a role for TRPV2 in PCa progression to the aggressive castration-resistant stage, prompting evaluation of TRPV2 as a potential prognostic marker and therapeutic target in the setting of advanced PCa.
20093382 TRPV2 negatively controls glioma cell survival and proliferation, as well as resistance to Fas-induced apoptotic cell death in an ERK-dependent manner.
19619644 TRPV1-immunoreactivity was significantly higher and TRPV2-immunoreactivity was significantly lower in peripheral blood mononuclear cells from end-stage kidney disease patients compared to controls.
19482060 The reduction of TRPV2 and TRPM8 immunoreactive nerve fibers in skin from individuals with Norrbottnian congenital insensitivity to pain further suggests that these ion channels are expressed primarily on nociceptive primary sensory neurons.
18983665 relative gene expression ofTRPV1-4 in leukocytes is: TRPV3 < TRPV4, TRPV1 and TRPV2; leukocytes in hyposensitive subjects showed up-regulation of TRPV1, which was almost doubly expressed
18787888 Messenger RNA transcripts of TRPVs 1 through 4 are detected for the first time in human pulmonary artery smooth muscle cells.
17977643 A progressive loss of s-TRPV2 accompanied by an increase of hTRPV2 expression was found in high-grade and -stage UC.
16882997 The TRPV2 ARD provides the first structural insight into a domain that coordinates nociceptive sensory transduction and is likely to be a prototype for other TRPV channel ARDs
16777226 Both TRPV1 and TRPV2 are found in human peripheral blood lymphocytes.
16533525 It is concluded that PI3-kinase induces or modulates the activity of recombinant TRPV2 channels; in contrast to the previously proposed mechanism, activation of TRPV2 channels by PI3-kinase is not due to channel translocation to the plasma membrane.
15249591 TRPV2 and PKA have roles as a signaling module for transduction of physical stimuli in mast cells

AA Sequence

MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPD      1 - 70
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQ     71 - 140
IDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGE    141 - 210
LPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARL    211 - 280
CPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCE    281 - 350
ENSVLEIIAFHCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA    351 - 420
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALLTVVSQVLCFL    421 - 490
AIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLIYLVFLFGFAVALVSLSQEA    491 - 560
WRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLELFKFTIGMGELAFQEQLHFRGMVLLLLLAYV    561 - 630
LLTYILLLNMLIALMSETVNSVATDSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDE    631 - 700
RWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN          701 - 764
//

Text Mined References (48)

PMID Year Title
26416880 2015 Nerve Growth Factor Regulates Transient Receptor Potential Vanilloid 2 via Extracellular Signal-Regulated Kinase Signaling To Enhance Neurite Outgrowth in Developing Neurons.
25869297 2015 The cation channel Trpv2 is a new suppressor of arthritis severity, joint damage, and synovial fibroblast invasion.
25641129 2015 Distribution of TRPV1 and TRPV2 in the human stellate ganglion and spinal cord.
25333484 2014 Dissecting domain-specific evolutionary pressure profiles of transient receptor potential vanilloid subfamily members 1 to 4.
25268680 2015 Mechanosensitive Ca²?-permeable channels in human leukemic cells: pharmacological and molecular evidence for TRPV2.
25001513 2014 Advances in transient receptor potential vanilloid-2 channel expression and function in tumor growth and progression.
24878697 2014 Overexpression of transient receptor potential vanilloid 2 is associated with poor prognosis in patients with esophageal squamous cell carcinoma.
24764033 2014 Distribution of TRPVs, P2X3, and parvalbumin in the human nodose ganglion.
24475260 2014 An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca²? rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24206072 2013 The potential role of transient receptor potential type A1 as a mechanoreceptor in human periodontal ligament cells.
23964684 Lysophosphatidylcholine-induced cytotoxicity in osteoblast-like MG-63 cells: involvement of transient receptor potential vanilloid 2 (TRPV2) channels.
23786999 2013 Blockade of sarcolemmal TRPV2 accumulation inhibits progression of dilated cardiomyopathy.
23741410 2013 TRPV2 mediates adrenomedullin stimulation of prostate and urothelial cancer cell adhesion, migration and invasion.
23542034 2013 Transient receptor potential vanilloid-2 mediates the effects of transient heat shock on endocytosis of human monocyte-derived dendritic cells.
23453732 2013 Targeting TRPV1 and TRPV2 for potential therapeutic interventions in cardiovascular disease.
23426965 2013 Involvement of TRPV2 and SOCE in calcium influx disorder in DMD primary human myotubes with a specific contribution of ?1-syntrophin and PLC/PKC in SOCE regulation.
23294145 2013 Transient receptor potential vanilloid 2 (TRPV2), a potential novel biomarker in childhood asthma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22327830 2012 Calcium regulation by thermo- and osmosensing transient receptor potential vanilloid channels (TRPVs) in human conjunctival epithelial cells.
21574765 2012 Mast-cell degranulation induced by physical stimuli involves the activation of transient-receptor-potential channel TRPV2.
21506114 2011 Thermosensitive transient receptor potential channels in human corneal epithelial cells.
20926660 2010 Ca2+-dependent desensitization of TRPV2 channels is mediated by hydrolysis of phosphatidylinositol 4,5-bisphosphate.
20686800 2011 Characterization of calmodulin binding domains in TRPV2 and TRPV5 C-tails.
20113837 2010 Clinical significance of transient receptor potential vanilloid 2 expression in human hepatocellular carcinoma.
20103638 2010 Role of cationic channel TRPV2 in promoting prostate cancer migration and progression to androgen resistance.
20093382 2010 TRPV2 channel negatively controls glioma cell proliferation and resistance to Fas-induced apoptosis in ERK-dependent manner.
19619644 2009 Up-regulation of TRPV1 in mononuclear cells of end-stage kidney disease patients increases susceptibility to N-arachidonoyl-dopamine (NADA)-induced cell death.
19482060 2009 Transient receptor potential vanilloid 1, vanilloid 2 and melastatin 8 immunoreactive nerve fibers in human skin from individuals with and without Norrbottnian congenital insensitivity to pain.
18983665 2008 Quantitative Real-Time PCR detection of TRPV1-4 gene expression in human leukocytes from healthy and hyposensitive subjects.
18787888 2008 Functional expression of transient receptor potential vanilloid-related channels in chronically hypoxic human pulmonary arterial smooth muscle cells.
17977643 2008 Transient receptor potential vanilloid type 2 (TRPV2) expression in normal urothelium and in urothelial carcinoma of human bladder: correlation with the pathologic stage.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16882997 2006 Crystal structure of the human TRPV2 channel ankyrin repeat domain.
16777226 2007 Expression of transient receptor potential vanilloid 1 (TRPV1) and 2 (TRPV2) in human peripheral blood.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16533525 2006 PI3-kinase promotes TRPV2 activity independently of channel translocation to the plasma membrane.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15249591 2004 A TRPV2-PKA signaling module for transduction of physical stimuli in mast cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12765698 Role and regulation of TRP channels in neutrophil granulocytes.
12765693 TRPV channels as temperature sensors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093812 2002 Molecular determinants of permeation through the cation channel TRPV4.
12077606 2002 TRPV3 is a temperature-sensitive vanilloid receptor-like protein.
10887936 2000 Capsaicin receptor in the pain pathway.
10201375 1999 A capsaicin-receptor homologue with a high threshold for noxious heat.