Property Summary

NCBI Gene PubMed Count 276
PubMed Score 1625.17
PubTator Score 1421.02

Knowledge Summary

Patent (128,541)

Expression

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
488979 confirmatory 0 / 76 / 1149 HTS Assay for Compounds that Act as Enhancers of the Vanilloid Receptor 1
488988 summary 0 / 0 / 0 HTS Assay for Compounds that Act as Enhancers of the Vanilloid Receptor 1: Summary
540275 screening 617 / 19352 / 297005 HTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1
540277 screening 53 / 9844 / 307077 HTS Assay for Compounds that Act as Potentiators of the Vanilloid Receptor 1
588633 other 66 / 0 / 31 Confirmatory screen for compounds that act as agonists of the Vanilloid Receptor 1 using automated patch clamp
602331 other 2 / 0 / 5 Confirmatory screen for compounds that act as allosteric agonists of TRPV1 using QPatch automated patch clamp
623958 confirmatory 0 / 0 / 1358 qHTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1: Hit Validation
623959 confirmatory 3 / 109 / 1246 qHTS Assay for Compounds that Act as Potentiators of the Vanilloid Receptor 1: Hit Validation
623960 confirmatory 1 / 0 / 0 qHTS Assay for Compounds that Act as Agonists of the Vanilloid Receptor 1: Hit Validation in Parental Cell Line Calcium Assay

Gene RIF (255)

PMID Text
27333657 It is expressed in the unmyelinated C fiber nociceptors and activated by various nociceptive stimuli causing pain in our body.(review)
27038373 the major objective of this review is to highlight the fact that TRPV1 channel can be treated as an effective therapeutic target for treating several pain- and nonpain-related physiological and pathological states.
26755770 No change in tmFRET was observed with the TRPV1 agonist capsaicin.
26753651 high expression of TRPV1 in urothelium of female overactive bladder(OAB) patients is closely correlated to OAB occurrence.
26752109 HRH1-mediated sensitization of TRPV1 is involved in IBS. Ebastine, an antagonist of HRH1, reduced visceral hypersensitivity, symptoms, and abdominal pain in patients with IBS.
26702055 Thus, the hTRPV1 channel has a heterogeneous subunit composition in terms of both redox status and function.
26700618 Data show that the number of transient receptor potential vanilloid 1 (TRPV1)+/CD4+ inflammatory cells increased in the nasal mucosa of patients with allergic rhinitis (AR), compared with that of control subjects.
26645885 The effects of specific agents on TRPV1 and TRPM8 channels are intricately interrelated.
26530852 TRPV1 was expressed in tongue, epiglottis, and pharynx, with higher levels in CN V region (tongue) than in CN X region (epiglottis), and was localized at epithelial cells and nociceptive fibers in all studied regions.
26490328 activation of astrocytic TRPV1 activates endogenous neuroprotective machinery in vivo and it is a novel therapeutic target for the treatment of Parkinson's disease
26436415 Supraspinal/brain transient receptor potential subfamily V member 1 is known to modulate pain processing.
26420335 RhTx binding to the outer pore can induce TRPV1 heat activation.
26387947 TRPV1 is a molecular co-detector of body temperature and osmotic stress.
26343051 Studies indicate that crosstalk between cannabinoid receptor type 1 (CB1) and transient receptor potential vanilloid 1 (TRPV1) modulates pain and inflammation in arthritis.
26337663 This study suggests that the circadian rhythm in the esophagus may be important for the mediation of and/or the response to erosive damage in GERD patients.
26294672 These findings suggested that the pathophysiology of heartburn sensation or esophageal hypersensitivity may be associated with the activation of PAR-2, TRPV1, and acid-sensing ion channels.
26283426 These findings suggest that the TRPA1-TRPV1 interaction may play an important role in regulating the function and excitability of pulmonary sensory neurons during airway inflammation
26146187 Interaction between the linker, pre-S1, and TRP domains determines folding, assembly, and trafficking of TRPV1 and TRPV4 channels.
26054320 In primary human monocytes TRPA1 and TRPV1 were expressed. TRPV1 mRNA expression was suppressed at 32 degrees C but not at 39 degrees C.
25911511 Levels of the TRPV4 agonist 5,6-EET, but not levels of TRPV1 or TRPA1 agonists, were increased in IBS biopsies compared with controls.
25814480 This review focuses on the current knowledge of TRPV1 in improving VSMC function and attenuating hypertension. [review]
25781982 and TRPV1 have different sensitivities toward membrane phospholipids, such as PI(4)P, PI(4,5)P2, and AA, although they have common roles as proton sensors.
25715236 higher expression in peripheral blood of the asthma patients
25670203 Activation of TRPV1 channels with capsaicin inhibits mechanosensitive Piezo channel activity by depleting membrane phosphoinositides.
25666878 N-acetyl cysteine reduced oxidative stress, apoptosis, cytokine levels, and Ca(2+) entry through TRPV1 channel, which provide supportive evidence that oxidative stress and TRPV1 channel plays a key role in etiology of polycystic ovary syndrome.
25642661 tramadol and M1 selectively inhibit the function of hTRPA1, but not that of hTRPV1
25641129 There appears to be TRPV1- or TRPV2-IR sympathetic pathway in the human stellate ganglion and spinal cord.
25585038 TRPV1 expression level, IL-4 level, and rs4790522 site mutation are the main risk factors inducing bronchial asthma in children
25561742 data demonstrate that phospholipids, specifically phosphoinositides, are important regulators of TRPV1 and are required for heat-induced channel activity.
25505315 TRPV1 channels can modify synaptic function in the brain by compartment.
25481381 Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation.
25449039 Data suggest TRPV1 and TRPV4 play roles in mediating various forms of myocardial ischemic preconditioning; TRPV1 activation appears to have cardioprotective effects; TRPV4 activation appears to preserve vascular function in ischemic heart. [REVIEW]
25445434 This review focus is on the regulation of TRPV1's function by lysophosphatidic acid as well as on recent results about the regulation of this ion channel by lipids structurally similar to lysophosphatidic acid. [review]
25425643 PI(4,5)P2 binding induces conformational rearrangements of the structure formed by S6 and the TRP domain, which cause an opening of the lower TRPV1 channel gate
25336328 esophagitis increases mRNA expressions of P2X3 and P2X7 receptors accompanied by up-regulation of TRPV1 and neurotrophic factors (NGF and GDNF).
25333484 Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4
25319702 Different acute pain states and itch were found to be transmitted in TRPV1 neurons.
25301060 TRPV1 protein channel is involved in cigarette smoke-induced ATP release in the lung.
25288608 the existence of a TRPV1-LI innervation in human scalp arteries and provides the first quantitative assessment of the TRPV1, CGRP and subance P innervation of those vessels
25266715 fibroblast growth factor-17 and neuregulin 2 were significantly up-regulated in capsaicin-treated epi 4 cells. results suggest that functional TRPV1 is expressed by GECs and contributes to the regulation of cell proliferation.
25257701 Genetic variation in TRPV1 and TAS2Rs influence sensations from sampled EtOH and may potentially influence how individuals initially respond to alcoholic beverages.
25216685 High TRPV1 expression is associated with osteoporosis in thalassemia major.
25210497 TRPV1 may play a crucial role in 14,15-epoxyeicosatrienoic acid -induced calcium influx, nitric oxide production and angiogenesis.
25170901 The described L-carnitine osmoprotective effect is elicited through suppression of hypertonic-induced TRPV1 activation leading to increases in L-carnitine uptake through a described Na(+)-dependent L-carnitine transporter
24931369 airway epithelial cells TRPV1 activation potently induces allergic cytokine thymic stromal lymphopoietin (TSLP) release
24889371 TRPV1 over-expression may be an effective way to induce necrosis and that this approach may not always be associated with enhancement of cancer cell proliferation.
24871046 Demonstrated how and why these TRP channels TRPV1, TRPA1, and TRPM8 are important to start up a systemic response of energy expenditure, energy allocation, and water retention and how this is linked to a continuously activated immune system in chronic inflammatory diseases. [Review]
24868547 sensory proteins P2X3 and TRPV1 are in correlation with urothelial differentiation, while P2X5 and TRPV4 have unique expression patterns
24798548 TRPV1 channels are activated by intracellular long-chain acyl CoAs
24764033 TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve
24720453 genetic polymorphism of TRPV1 945G>C could be one of the pathophysiological factors of FD, especially in the case of H. pyloripositive patients in Korea.
24658385 Degradation of TRPV1 is mediated by autophagy, and that this pathway can be enhanced by cortisol.
24599956 the signaling lipid phosphoinositide 4,5-bisphosphate (PI(4,5)P2) has opposite effects on the function of TRPV1 ion channels depending on which leaflet of the cell membrane it resides in.
24569998 furanocoumarins represent a novel group of TRPV1 modulators that may become important lead compounds in the drug discovery process aimed at developing new treatments for pain management.
24564662 There is now mounting evidence that TRPV1 receptors may be an important element in modulation of nociceptive information at the spinal cord level and represent an interesting target for analgesic therapy. [review]
24564660 Comparison of the effects induced by mutations in homologous positions in different TRP receptors (or more generally in other distantly related ion channels) may elucidate the gating mechanisms conserved during evolution. [review]
24458144 TRPV1-immunoreactive nerve fibers and NGF have a role in inflammation in interstitial cystitis/bladder pain syndrome
24340836 Our study demonstrates that TRPV1 may be a susceptible gene for type 1 diabetes in an Ashkenazi Jewish population
24312564 intact 2-arachidonoylglycerol and 1-arachidonoylglycerol are endogenous TRPV1 activators
24296694 Laryngeal TRPV1 plays an important role in cough sensitivity.
24275229 sensitization of TRPV1 via activation of TRPA1, which involves adenylyl cyclase, increased cAMP, subsequent translocation and activation of PKA, and phosphorylation of TRPV1 at PKA phosphorylation residues.
24190005 In Burning mouth syndrome patients was increased TRPV1, decreased CB1 and increased CB2 expression in tongue epithelial cells also associated with a change in their distribution.
24189713 TRPV1 mRNA or protein expression is not increased in the rectal mucosa of Irritable bowel syndrome patients,including visceral hypersensitivity.
24152419 There is increased TRPV1 immunoreactivity in human osteoarthritis synovium, confirming the diseased joint as a potential therapeutic target for TRPV1-mediated analgesia.
24139494 IR features an overexpression of TRPV1 in the nasal mucosa and increased SP levels in nasal secretions. Capsaicin exerts its therapeutic action by ablating the TRPV1-SP nociceptive signaling pathway in the nasal mucosa.
24098582 TRPV1 potentiates TGFbeta-induction of corneal myofibroblast development through an oxidative stress-mediated p38-SMAD2 signaling loop.
24084605 In uveal melanoma cells, TRPV1, TRPA1 and TRPM8 gene expression were identified.
24073800 The degradation of claudin-3 and claudin-4 induced by acidic stress could be attenuated by specific TRPV1 blockers.
24002057 Rhinovirus infection causes upregulation of neuronal TRPV1 expression mediated indirectly by virus-induced soluble factors.
23902373 Evodiamine qualifies as structurally unique lead structure to develop new potent TRPV1 agonists/desensitizers.
23820422 Data suggest that expression of neuronal markers VR1 (vanilloid receptor 1), PGP9.5 (ubiquitin C-terminal hydroxylase-L1, human), and NGFp75 (p75 neurotrophin receptor) in endometrium of women is independent of presence of endometriosis.
23709255 TRPV1 is expressed in cells that are particularly active in Ca(2) exchange as well as in cells with significant water transport activity in eyes of New Zealand White rabbits and humans
23699529 The results of this study suggested that antagonizing the TRPV1-AKAP79 interaction will be a useful strategy for inhibiting inflammatory hyperalgesia.
23689362 TRPV1 is a critical disease modifier in experimental autoimmune encephalomyelitis, and we identify a predictor of severe disease course and a novel target for MS therapy.
23616546 Disruption of the interaction of TRPV1 and an anchoring protein AKAP79 inhibits inflammatory hyperalgesia.
23510405 This study evaluated the presence of TRPV1 in human and canine mammary cancer cells and the role of TRPV1 in regulating cell proliferation.
23508958 Excitation and modulation of TRPA1, TRPV1, and TRPM8 channel-expressing sensory neurons by the pruritogen chloroquine.
23458684 the activation of TRPM2 channel, which mediates ATP release, and TRPV1 channel plays significant roles in the cellular responses to DNA damage induced by gamma-irradiation and UVB irradiation.
23453732 TRPV1 and TRPV2 are potential targets for potential therapeutic interventions in cardiovascular disease.
23398938 This study demonstrated an increased activity of TRPV1 in DRG neurons as a new mechanism contributing to opioid withdrawal-induced hyperalgesia.
23279936 these results propose a novel mechanism by which cellular cholesterol depletion modulates the function of TRPV1.
23264624 the direct anchoring of both PKA and AC to TRPV1 by AKAP79/150 facilitates the response to inflammatory mediators and may be critical in the pathogenesis of thermal hyperalgesia.
23183769 an inward calcium current via the TRPV1 channels of endothelial cells correlates with a stronger adhesion between monocytes and endothelial cells
23139219 Capsaicin inhibits chloride secretion in part by causing NKCC1 internalization, but by a mechanism that appears to be independent of TRPV1.
23123284 These results indicate that CGRP may participate in trigeminal nociceptive system sensitization by induced increase in TRPV1
23074220 analysis of the functional interactions between MRGPR-X1 and TRPV1
23047628 Single nucleotide polymorphism of TRPV1 315G>C, rs5981521 of pri-miR-325 and SCN10A is related to the development of functional dyspepsia. This involvement differed between Helicobater pylori-positive and -negative patients.
22942745 This study is the first to shed light on the structural determinants required for the interaction between TRPV1 and evodiamine, and gives new suggestions for the rational design of novel TRPV1 ligands.
22936245 mRNA and protein levels of TRPV1 are upupregulated in the brain from patients with mesial temporal lobe epilepsy
22935106 findings strongly suggest that TRPV1 sensitization influences the hypersecretion of mucus and inflammatory cytokines
22883519 The expression of TRPV1 was correlated with the degree of pain in patients with endometriosis.
22870787 Results suggest that the single nucleotide polymorphisms of the TRPV1 gene may not be associated with irritable bowel syndrome in Korean populations.
22829138 particulate matter induces TRPV1 channel opening, resulting in increase of Ca2+ concentration and cAMP level, and all these responses lead to mucin protein secreted from human bronchial epithelial cells.
22820645 TRPV1 is highly expressed in tumor & weakly expressed in tumor-free brain. Endovanilloidsfrom neural precursor cells activates TRPV1 in high-grade astrocytomas. TRPV1 stimulation triggers tumor cell death via the endoplasmic reticulum stress pathway.
22814029 This is the first evidence that CB(2) and TRPV(1) receptors cooperate to modulate MDR1 expression.
22809607 TRPV1 gene polymorphisms at positions rs222748 and rs8065080 may be unrelated to nonspecific chronic cough in children.
22792722 Interaction of sea amemone Heteractis crispa Kunitz type polypeptides with pain vanilloid receptor TRPV1
22691178 The increase in capsaicin sensitivity correlated with increased urothelial TRPV1 expression in overactive bladder cells.
22647236 The over-expression of TRPV1 in cortical lesions of tuberous sclerosis complex and focal cortical dysplasia type suggested the possible involvement of TRPV1 in the intrinsic and increased epileptogenicity of malformations of cortical development
22570472 N-glycosylation determines ionic permeability and desensitization of the TRPV1 capsaicin receptor
22568077 TRPV1 mRNA was detected in hPDL cells and the TRPV1 expression was observed by confocal laser scanning microscope
22566504 Data show the expression of TRPC6 and TRPV1 was significantly increased after 24 hours of exposure to an atheroprone flow, whereas the expression of TRPC3 and TRPM7 was significantly higher in endothelial cells exposed to shear stress.
22556011 The results suggested that the increased TRPV1-positive nerve fibers may integrate various stimuli on peripheral terminals or primary sensory neurons and generate hyperalgesia in endometriosis.
22518827 TRPV-1 channels participate in reflex cutaneous vasodilation.
22493457 TRPV1 agonists induce long-term receptor down-regulation by modulating the expression level of the channel through a mechanism that promotes receptor endocytosis and degradation
22443337 TRPV1 single nucleotide polymorphisms may enhance susceptibility to cough in current smokers and in subjects with a history of workplace exposures.
22401740 Increased frequency of the Met315Ile TRPV1 genotype in females diagnosed with neuropathic pain suggests that this polymorphism, together with other physiological factors such as sex, may influence individual susceptibility to neuropathic pain.
22389490 20-HETE both activates and sensitizes mouse and human TRPV1, in a kinase-dependent manner, involving the residue Ser(502) in heterologously expressed hTRPV1
22327830 Cultivated HCjE cells and human conjunctiva express TRPV1, mRNA.
22262885 The results of this study provided the first evidence that TRPV1 channels regulate cortical excitability to paired-pulse stimulation in humans.
22262838 role of TRPV1 in modulating microtubule assembly/disassembly and suggests the participation of these two players in a feedback cycle linking nociception and cytoskeletal remodeling.
22260796 data illustrate that presynaptic calcineurin activity is required for both TRPV1-induced long-term depression(LTD)and TRPV1 agonist-induced depression; finding is the first to demonstrate the TRPV1-induced signaling mechanism in CA1 hippocampus
22242698 TRPV1 can be expressed on bronchial fibroblasts in situations where an underlying inflammatory stimulus exists, as is the case in airway diseases such as asthma and COPD.
22171160 TRPV1 induced increases in IL-6/IL-8 release occur through TAK1 activation of JNK1-dependent and JNK1-independent signaling pathways.
22162417 Nominal association was confirmed for TRPV3 rs7217270 in migraine with aura and TRPV1 rs222741 in the overall migraine group.
22089942 In addition, the present study demonstrates that capsaicin's inhibitory effect on collagen-induced canine platelet aggregation is not mediated by TRPV1.
21981454 Agonists of TRPV1 and TRPA1 induced MUC5B release in the human nasal airways in vivo.
21962912 Agonist-induced activation of nociceptors by TRPA1 and TRPV1 elicits painful sensations, whereas nonneuronal tissue cells respond with differential release of inflammatory mediators, thus influencing local vasodilatation and neuronal sensitization.
21960521 HCl-induced activation of TRPV1 causes ATP release from esophageal epithelial cells that causes release of CGRP and SP from esophageal submucosal neurons.
21956871 These results suggest that TRPV1 is expressed in myoepithelial cells of the human submandibular gland and mediates myoepithelial contraction via a mechanism involving MLC(20) phosphorylation.
21951314 These findings may indicate that TRPV1 is not a key mediator of the symptoms in seasonal allergic rhinitis
21945155 Activation of TRPV1 translates into changes of intracellular Ca(2+), a known mechanism triggering the secretion of chromogranin A
21926175 biochemical evidence of dimerization of TRPV1 subunits upon exposure to phenylarsine oxide and hydrogen peroxide
21911503 The chimeric approach reveals that differences in the TRPV1 pore domain determine species-specific sensitivity to block of heat activation.
21654202 This review summarizes the current knowledge of the molecular determinants of TRPV1 channel activation by heat, protons and capsaicin.
21616913 This indicates a role for the pro-nociceptive gene TRPV1 in genetic susceptibility to symptomatic knee OA, which may also be influenced by a role for this molecule in cartilage function.
21555515 there is a cholesterol-binding site in TRPV1 and that the functions of TRPV1 depend on the genetic variant and membrane cholesterol content.
21546516 This is the first study to report that the 57 kb deletion extends into the TRPV1 gene causing dysregulation of transcription in peripheral blood mononuclear cells isolated from cystinosis patients.
21506114 Human corneal epithelial cells possess thermosensitive TRPV1 activity.
21493704 TRPV1 activation in endothelial cells may trigger Ca(2+)-dependent PI3K/Akt/CaMKII signalling, which leads to enhanced phosphorylation of TRPV1, increased TRPV1-eNOS complex formation, eNOS activation and, ultimately, NO production.
21451044 TRPV1 expression reveals a high density of receptors in discrete brain regions of Trpv1 reporter mice, most notably in a contiguous band of cells within and adjacent to the caudal hypothalamus, and in arteriolar smooth muscle cells.
21351130 in female patients with overactive bladder symptoms, urothelial cells demonstrated augmented trpv1 signaling.
21345654 blockade of TRPV1 activation can suppress the atopic dermatitis-like symptoms by accelerating skin barrier recovery
21310942 Loss of TRPV1 is associated with urothelial cancer.
21285946 The authors conclude that proton activation and potentiation of TRPV1 are both voltage dependent and that amino acid 660 is essential for proton-mediated gating of TRPV1.
21168271 Western blotting confirms gene and protein expression of functional TRPV1 channel, which plays a crucial role in mediating thermal sensation in teeth.
21160085 The present study shows that TRPV1 expression in peritoneal endometriosis foci is related to chronic pelvic pain in women.
21083604 Downregulation of TRPV1 mRNA expression may represent an independent negative prognostic factor for bladder cancer patients.
21076424 TRPV1 channels modulate synaptic strength in a cell type-specific manner in the nucleus accumbens.
21076423 Activation of TRPV1 by endogenous anandamide mediates regulation of synaptic strength at central synapses.
21044960 the charged residues in S4 and the S4-S5 linker contribute to voltage sensing in TRPV1 and, despite their highly conserved nature, regulate the temperature and chemical gating in the various TRPV channels in different ways
21037510 Observational study of gene-disease association. (HuGE Navigator)
20807792 A portion of the NO component of thermal hyperaemia may be due to activation of TRPV-1 channels.
20696376 The proper function of transgenic NompC, a putative Drosophila mechanosensitive TRP channel, is not only required for fly locomotion, but also crucial for larval crawling.
20691059 These findings and those of others reported in the literature indicate reciprocal interactions between TRPV1 and ROS play critical roles in the pathological and nociceptive responses active during arthritic inflammation.
20639579 Genetically determined level of TRPV1 activity is relevant for asthma pathophysiology.
20639579 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20518854 Transient receptor potential vanilloid-1 mRNA level and its protein expression were significantly greater in patients with erosive esophagitis than asymptomatic patients and healthy controls.
20515731 Studies indicate that there is evidence that TRPV1 forms heteromeric channel complexes.
20456759 Increased TRPV1 in the esophageal mucosa may contribute to symptoms both in non-erosive reflux disease and erosive esophagitis patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351268 the turret is part of the temperature-sensing apparatus in thermoTRP channels, and its conformational change may give rise to the large entropy that defines high temperature sensitivity
20190512 PKC-dependent potentiation of TRPV1 activities under hypoxia and hyperglycemia might be involved in early diabetic neuropathy.
20145248 analysis of the structural basis for proton and magnesium modulation of fully capsaicin-bound human TRPV1 receptors and comparison to rat receptors
20096818 OTR and TRPV1 may be involved in dysmenorrhea and its severity in adenomyosis
20060270 One of the mechanisms of glycolic acid(GA)-induced epidermal proliferation is a growth response of basal keratinocytes to the local elevation of H(+)-ion concentration by infiltrated GA. This response is mediated by TRPV1 activation and ATP release.
20034385 Polymorphisms in gene encoding TRPV1-receptor involved in pain perception are unrelated to chronic pancreatitis.
20034385 Observational study of gene-disease association. (HuGE Navigator)
19959817 esophageal epithelial cells produce PAF in response to TRPV1-mediated calcium elevation
19923855 Since the number of TRPV1 receptor-positive nonneural cells is increased in inflammatory conditions, we hypothesize that TRPV1-receptor-mediated processes might play role in the pathogenesis of OLP.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19877503 UTR-3 polymorphisms in TRPV1 could be associated with the susceptibility to childhood asthma of Han Nation ethnic group in Beijing.
19877503 Observational study of gene-disease association. (HuGE Navigator)
19778904 endoplasmic reticulum of dorsal root ganglion neurons contains functional TRPV1 channels
19770677 Homozygous TRPV1 315C influences the susceptibility to functional dyspepsia in a Japanese population through altering the upper gastrointestinal sensation
19770677 Observational study of gene-disease association. (HuGE Navigator)
19749171 REVIEW: data on the distribution of TRPV1 channels in the body and on thermoregulatory responses to TRPV1 agonists and antagonists
19656659 Endogenous expression of TRPV1 channel in cultured human melanocytes. (Letter)
19651168 The results show that TRPV1 protein expression increases during RA-induced differentiation in vitro, which generates an altered intracellular Ca(2+) homeostasis.
19619644 TRPV1-immunoreactivity was significantly higher and TRPV2-immunoreactivity was significantly lower in peripheral blood mononuclear cells from end-stage kidney disease patients compared to controls.
19608651 Human spermatozoa exhibit a completely functional endocannabinoid system related to anandamide, and the anandamide-binding TRPV1 receptor could be involved in the sperm fertilizing ability.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19482060 Nerve fibers in human skin express TRPV1, TRPV2 and TRPM8 that co-localize with the sensory neuropeptides CGRP and SP, but not with NF200, VIP or TH.
19397909 These data introduce TRPV1-coupled signaling as a novel player in human monocyte-derived DC biology with anti-inflammatory actions.
19333172 The TRPV1 was increase in the peritoneum of women with chronic pelvic pain.
19328632 Moreover, TRPV1 activation triggers apoptotic neuronal death of rat cortical cultures, which may be responsible, at least in part, for the volume loss of neocortex in chronic epilepsy.
19161409 expression of TRPV1 is affected by both the intrinsic ageing and photoaging processes
19074743 Together with TRPV1, the capsaicin receptor, transient receptor potential cation channel subfamily A member 1 ankyrin may contribute to chemical hypersensitivity, chronic cough, and airway inflammation --{REVIEW}
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19036069 presence of TRPV1 may provide a link between inflammatory mediators and platelet activation
18983665 relative gene expression ofTRPV1-4 in leukocytes is: TRPV3 < TRPV4, TRPV1 and TRPV2; leukocytes in hyposensitive subjects showed up-regulation of TRPV1, which was almost doubly expressed
18852901 Although keratinocytes express TRPV1 mRNA, neither responded to vanilloids with Ca(2+)-cytotoxicity
18830626 Increased genetic expression may serve as a prognostic factor in prostate cancer.
18791833 Full-length TRPV1 has been modeled by assembly of its major modules: the cytosolic N-terminal, C-terminal, and membrane-spanning region, by modeling of the vanilloid receptor in the closed and desensitized states.
18787888 May be a mediator or part of a critical pathway in chronic hypoxia-induced proliferation of human pulmonary artery smooth muscle cells.
18786439 Disease-free survival was significantly better in HCC patients with high versus those with low VR1 expression levels.
18769453 TRPV1 signaling is a significant, previously unreported player in human sebocyte biology
18584893 TRPV1 regulates the expression and secretion of endothelial cell-derived CGRP.
18574245 PI(4,5)P(2), and not other phosphoinositides or other lipids, is the endogenous phosphoinositide regulating TRPV1 channels
18559878 findings suggest that modification of I696, W697, & R701 to alanine altered channel function by affecting events downstream of initial stimuli-sensing step & imply that intersubunit interactions within the TRP box play an important role in TRPV1 gating.
18552442 expressed in airway C fibers and activated by neurogenic inflammation which leads to provocaion of cough reflex.
18503554 TRPV1 mediates heat shock-induced MMP-1 expression via calcium-dependent PKCalpha signaling in HaCaT cells
18499726 The results of this study support the hypothesis that 4-ONE is a relevant endogenous activator of vagal C-fibres via an interaction with TRPA1, and at less relevant concentrations, it may activate nerves via TRPV1.
18482991 Increased translocation and multimerization of TRPV1 channels provide a cellular mechanism for fine-tuning of nociceptive responses that allow for rapid modulation of TRPV1 responses independent of transcriptional changes.
18414789 Ara C treatment blocked insertion of TRPV1 in the cell membrane, resulting in accumulation of the receptors in the cytoplasm, loss of capsaicin sensitivity, and membrane-bound immunostaining, which was restored with a rebound on withdrawal of Ara C.
18267041 TRPV1 may be involved in pain mechanisms associated with cervical ripening and labor.
18230619 several proton-sensitive sites on the extracellular side of the pore-forming loop of the TRPV1 channel may play an important role as a brake to suppress the excessive activity of this channel under physiological conditions.
18222434 Testicular hyperthermia in mice lacking transient receptor potential vanilloid receptor-1 results in a much more rapid and massive germ cell depletion from the seminiferous tubules than in wild-type animals.
18076848 Increased expression within the pulps of hypomineralised teeth may be indicative of an underlying pulpal inflammation
17927589 TRPV1 expression was significantly increased in distal small nerve fibre neuropathy compared with controls.
17913835 Incorporation of multiple nonsynonymous polymorphisms, informed by the population-specific haplotype block structure of the TRPV1 gene
17659837 These data provide the first clinical evidence that a TRPV1 antagonist may alleviate pain and hyperalgesia associated with inflammation and tissue injury.
17626206 Tonic activation of TRPV1 channels in the abdominal viscera by yet unidentified nonthermal factors inhibits skin vasoconstriction and thermogenesis, thus having a suppressive effect on body temperature.
17596456 We conclude that phosphoinositides have both inhibitory and activating effects on TRPV1, resulting in complex and distinct regulation at various stimulation levels.
17582772 TRPV1-positive fibres were overall significantly increased in tongue of Burning mouth syndrome.
17567713 a novel group of compounds that activate TRPV1 and, consequently, provide a molecular mechanism that may account for off tastes of sweeteners and metallic tasting salts
17560936 Here, we demonstrate the expression of TRPV1 in synovial fibroblasts (SF) from patients with symptomatic osteoarthritis (OA) and rheumatoid arthritis (RA).
17521436 accumulation of TRPV1 and TRPV3 in peripheral nerves after injury, in spared axons, matches our previously reported changes in avulsed DRG.
17508360 TRPV1 activation induces inflammatory cytokine release in corneal epithelium through MAPK signaling.
17508023 Heat-shock-induced MMP-1 expression is mediated by activation of TRPV1 and is dependent on a calcium-dependent signaling process in human epidermal keratinocytes.
17442052 The advantage of SH-SY5Y(hTRPV1) is the ability of hTRPV1 to couple to neuronal biochemical machinery and produce large quantities of cells.
17442041 TRPV1 gene and protein expression inversely correlated with glioma grading, with marked loss of TRPV1 expression in the majority of grade IV glioblastoma multiforme.
17428642 Recent studies indicate that primary sensory neurons of the pancreas express transient receptor potential V1 (TRPV1) channels whose activation induces pancreatic inflammation
17392452 Together, these results indicate that tonic TRPV1 activation regulates body temperature. TRPV1 function in thermoregulation is conserved from rodents to primates.
17385724 IGF-I and insulin enhance TRPV1 protein expression and activity, and impaired pain sensation might result from distorted TRPV1 regulation in the peripheral nervous system
17347480 Capsaicin-induced calcium influx through TRPV1 channels prevents adipogenesis, prevents downregulation of TRPV1 expression and prevents obesity.
17217056 TRPV1 is a nonselective cation channel with significant permeability to calcium, protons, and large polyvalent cations--{REVIEW}
17184838 we assigned a novel role to capsaicin-sensitive TRPV1 channels. They are important Ca2+ influx channels required for cell migration.
17176640 Gingerols and shogaols activated TRPV1 and increased adrenaline secretion.
17109831 These data do not rule out involvement of TRPV1 in the aetiology of burning dysaesthesia following lingual nerve injury but suggest that TRPV1 at the injury site does not play a primary role.
17074976 We propose a new model for nerve growth factor (NGF)-mediated hyperalgesia in which physical coupling of TRPV1 and PI3K in a signal transduction complex facilitates trafficking of TRPV1 to the plasma membrane.
17018028 data support the hypothesis that the TRPV1b splice variant is a naturally existing inhibitory modulator of TRPV1.
17016800 TRPV1 may play a role in urinary sensory urgency and premature first bladder sensation on filling.
16996800 Here, we review the potential therapeutic indications and adverse effects of TRPV1 antagonists.
16996476 TRPV1 antagonists, including TRPV1 siRNAs, have potential in the treatment of both, neuropathic and visceral pain
16842630 Opioid receptor agonist morphine acts via inhibition of adenylate cyclase to inhibit protein kinase A-potentiated TRPV1 responses.
16793902 PAR2 activates PKCepsilon and PKA in sensory neurons, and thereby sensitizes TRPV1 to cause thermal hyperalgesia
16777226 Both TRPV1 and TRPV2 are found in human peripheral blood lymphocytes.
16406364 Results describe the modification of 12-phenylacetyl-ricinoleoyl-vanillamide and its activity at TRPV1 and CB2 receptors.
16319926 NGF rapidly increases membrane expression of TRPV1 heat-gated ion channels
16301147 may play a role in maintenance of the physiologic condition of the TMJ
16099171 Gadolinium activates and potentiates the TRPV1 by neutralizing two specific proton-sensitive sites on the extracellular side of the pore-forming loop.
16081411 several endogenous non-cannabinoid N-acylethanolamines activate TRPV(1)
15992990 A progressive loss of TRPV1 expression in the urothelium as TCC stage increased and cell differentiation was lower.
15793280 TRPV1 as a significant novel player in human hair growth control.
15738111 expression of vanilloid receptor subtype-1 and acid-sensing ion channel genes in the human trigeminal ganglion neurons
15708075 Increased urothelial TRPV1 in patients with neurogenic detrusor overactivity may play a role in the pathophysiology, in concert with increased TRPV1 nerve fibers.
15691846 Ca2+-dependent desensitization of TRPV1 might be in part regulated through channel dephosphorylation by calcineurin
15685214 Piperine was agonistic to TRPV1 as measured by patch-clamp techniques. TRPV1 was antagonized by the competitive antagonist capsazepine and the non-competitive TRPV1 blocker ruthenium red.
15644492 TRPV1b receptors are expressed in trigeminal ganglion neurons and contribute to thermal nociception.
15574747 There is a minor role for transient receptor potential vanilloid receptor-1 as a mediator of cutaneous acid-induced pain.
15306801 temperature sensing is tightly linked to voltage-dependent gating in the cold-sensitive channel TRPM8 and the heat-sensitive channel TRPV1
15190102 Our observations suggest that the homologous TRP domain in the TRP protein family may function as a general, evolutionary conserved AD involved in subunit multimerization
15051629 Review notes that high expression of TRPV1 has been detected in inflammatory diseases of the colon and ileum, whereas neuropeptides released upon sensory nerve stimulation triggered by TRPV1 activation may play a role in intestinal motility disorders.
14987252 VR1 is widely distributed in the skin, suggesting a major role for this receptor, e.g. in nociception and neurogenic inflammation.
14630912 vanilloid receptor 1 has a role in regulating vanilloid binding with Ca2+/calmodulin-dependent kinase II
14520770 in fibers of human tooth pulp ... may play a role in perception of dental pain
14506258 Ser-116 and possibly Thr-370 are the most important residues involved in the cyclic AMP-dependent protein kinase pathway reduction of desensitization of capsaicin-activated currents.
14506258 Ser-116 and possibly Thr-370 of vanilloid receptor TRPV1 are the most important residues involved in the mechanism of PKA-dependent reduction of desensitization of capsaicin-activated currents
12812762 Proposal that residue Y671 is critical for the high relative Ca(2+) permeability of TRPV1 and participates in the structural rearrangements of the channel protein leading to Ca(2+)-dependent desensitization.
12808128 calmodulin binds to a 35-aa segment in the C terminus of TRPV1, and disruption of the calmodulin-binding segment prevents TRPV1 desensitization
12573376 In rectal hypersensitivity, nerve fibres immunoreactive to TRPV1 were increased in muscle, submucosal, and mucosal layers.
12393854 ASICs are leading acid sensors in human nociceptors and VR1 participates in the nociception mainly under extremely acidic conditions.
11884385 Direct phosphorylation of capsaicin receptor VR1 by protein kinase Cepsilon and identification of two target serine residues

AA Sequence

MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGEL      1 - 70
DSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKS     71 - 140
KKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQTALHIAI    141 - 210
ERRNMALVTLLVENGADVQAAAHGDFFKKTKGRPGFYFGELPLSLAACTNQLGIVKFLLQNSWQTADISA    211 - 280
RDSVGNTVLHALVEVADNTADNTKFVTSMYNEILMLGAKLHPTLKLEELTNKKGMTPLALAAGTGKIGVL    281 - 350
AYILQREIQEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLN    351 - 420
RLLQDKWDRFVKRIFYFNFLVYCLYMIIFTMAAYYRPVDGLPPFKMEKTGDYFRVTGEILSVLGGVYFFF    421 - 490
RGIQYFLQRRPSMKTLFVDSYSEMLFFLQSLFMLATVVLYFSHLKEYVASMVFSLALGWTNMLYYTRGFQ    491 - 560
QMGIYAVMIEKMILRDLCRFMFVYIVFLFGFSTAVVTLIEDGKNDSLPSESTSHRWRGPACRPPDSSYNS    561 - 630
LYSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKL    631 - 700
QRAITILDTEKSFLKCMRKAFRSGKLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGV    701 - 770
KRTLSFSLRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSGSLKPEDAEVFKSPAASGEK     771 - 839
//

Text Mined References (278)

PMID Year Title
27333657 2016 [Thermosensitive TRP channels and brain function].
27038373 2016 Polymodal Transient Receptor Potential Vanilloid Type 1 Nocisensor: Structure, Modulators, and Therapeutic Applications.
26755770 2016 Measuring distances between TRPV1 and the plasma membrane using a noncanonical amino acid and transition metal ion FRET.
26753651 Expression and diagnosis of transient receptor potential vanilloid1 in urothelium of patients with overactive bladder.
26752109 2016 Histamine Receptor H1-Mediated Sensitization of TRPV1 Mediates Visceral Hypersensitivity and Symptoms in Patients With Irritable Bowel Syndrome.
26702055 2016 Functional and Structural Divergence in Human TRPV1 Channel Subunits by Oxidative Cysteine Modification.
26700618 2016 The role of TRPV1 in the CD4+ T cell-mediated inflammatory response of allergic rhinitis.
26645885 2016 Reciprocal effects of capsaicin and menthol on thermosensation through regulated activities of TRPV1 and TRPM8.
26530852 2016 Localization and expression of TRPV1 and TRPA1 in the human oropharynx and larynx.
26490328 2015 TRPV1 on astrocytes rescues nigral dopamine neurons in Parkinson's disease via CNTF.
26436415 2015 Supraspinal Transient Receptor Potential Subfamily V Member 1 (TRPV1) in Pain and Psychiatric Disorders.
26420335 2015 A pain-inducing centipede toxin targets the heat activation machinery of nociceptor TRPV1.
26387947 2015 ?N-TRPV1: A Molecular Co-detector of Body Temperature and Osmotic Stress.
26343051 2015 Cannabinoid-based drugs targeting CB1 and TRPV1, the sympathetic nervous system, and arthritis.
26337663 2015 Changes in Gene Expression Patterns of Circadian-Clock, Transient Receptor Potential Vanilloid-1 and Nerve Growth Factor in Inflamed Human Esophagus.
26294672 2015 PAR-2 activation enhances weak acid-induced ATP release through TRPV1 and ASIC sensitization in human esophageal epithelial cells.
26283426 2015 Interaction between TRPA1 and TRPV1: Synergy on pulmonary sensory nerves.
26146187 2015 Interaction between the Linker, Pre-S1, and TRP Domains Determines Folding, Assembly, and Trafficking of TRPV Channels.
26054320 2015 TRPA1 mediates the effects of hypothermia on the monocyte inflammatory response.
25911511 2015 Quantification and Potential Functions of Endogenous Agonists of Transient Receptor Potential Channels in Patients With Irritable Bowel Syndrome.
25814480 2015 The role of TRPV1 in improving VSMC function and attenuating hypertension.
25781982 2015 Differential regulation of proton-sensitive ion channels by phospholipids: a comparative study between ASICs and TRPV1.
25715236 Effect of TRPV1 gene mutation on bronchial asthma in children before and after treatment.
25670203 2015 Activation of TRPV1 channels inhibits mechanosensitive Piezo channel activity by depleting membrane phosphoinositides.
25666878 2015 N-acetyl cysteine reduces oxidative toxicity, apoptosis, and calcium entry through TRPV1 channels in the neutrophils of patients with polycystic ovary syndrome.
25642661 2015 Tramadol and its metabolite m1 selectively suppress transient receptor potential ankyrin 1 activity, but not transient receptor potential vanilloid 1 activity.
25641129 2015 Distribution of TRPV1 and TRPV2 in the human stellate ganglion and spinal cord.
25585038 2015 Preliminary study on pathogenesis of bronchial asthma in children.
25561742 2015 Regulation of the temperature-dependent activation of transient receptor potential vanilloid 1 (TRPV1) by phospholipids in planar lipid bilayers.
25505315 2014 Compartment-specific modulation of GABAergic synaptic transmission by TRPV1 channels in the dentate gyrus.
25481381 2014 Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation.
25449039 2015 TRPV1 and TRPV4 channels: potential therapeutic targets for ischemic conditioning-induced cardioprotection.
25445434 2015 A painful link between the TRPV1 channel and lysophosphatidic acid.
25425643 2015 Molecular determinants of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) binding to transient receptor potential V1 (TRPV1) channels.
25336328 2014 Evidence for up-regulation of purinergic receptor genes associating with TRPV1 receptors and neurotrophic factors in the inflamed human esophagus.
25333484 2014 Dissecting domain-specific evolutionary pressure profiles of transient receptor potential vanilloid subfamily members 1 to 4.
25319702 2014 Multimodal use of calcitonin gene-related peptide and substance P in itch and acute pain uncovered by the elimination of vesicular glutamate transporter 2 from transient receptor potential cation channel subfamily V member 1 neurons.
25301060 2014 Role of transient receptor potential and pannexin channels in cigarette smoke-triggered ATP release in the lung.
25288608 2015 TRPV1, CGRP and SP in scalp arteries of patients suffering from chronic migraine.
25266715 2014 Epithelial TRPV1 signaling accelerates gingival epithelial cell proliferation.
25257701 2014 Polymorphisms in TRPV1 and TAS2Rs associate with sensations from sampled ethanol.
25216685 2014 Iron overload causes osteoporosis in thalassemia major patients through interaction with transient receptor potential vanilloid type 1 (TRPV1) channels.
25210497 2014 Implication of transient receptor potential vanilloid type 1 in 14,15-epoxyeicosatrienoic acid-induced angiogenesis.
25170901 2014 L-carnitine reduces in human conjunctival epithelial cells hypertonic-induced shrinkage through interacting with TRPV1 channels.
24931369 2014 Activation of TRPV1 mediates thymic stromal lymphopoietin release via the Ca2+/NFAT pathway in airway epithelial cells.
24889371 2014 Consequences of activating the calcium-permeable ion channel TRPV1 in breast cancer cells with regulated TRPV1 expression.
24871046 2014 TRPV1, TRPA1, and TRPM8 channels in inflammation, energy redirection, and water retention: role in chronic inflammatory diseases with an evolutionary perspective.
24868547 2014 Correlation between urothelial differentiation and sensory proteins P2X3, P2X5, TRPV1, and TRPV4 in normal urothelium and papillary carcinoma of human bladder.
24798548 2014 Intracellular long-chain acyl CoAs activate TRPV1 channels.
24764033 2014 Distribution of TRPVs, P2X3, and parvalbumin in the human nodose ganglion.
24720453 2014 Association of SLC6A4 5-HTTLPR and TRPV1 945G>C with functional dyspepsia in Korea.
24658385 2014 Transient receptor potential cation channel V1 (TRPV1) is degraded by starvation- and glucocorticoid-mediated autophagy.
24599956 2014 Regulation of TRPV1 ion channel by phosphoinositide (4,5)-bisphosphate: the role of membrane asymmetry.
24569998 2014 Furanocoumarins are a novel class of modulators for the transient receptor potential vanilloid type 1 (TRPV1) channel.
24564662 2014 Update on the role of spinal cord TRPV1 receptors in pain modulation.
24564660 2014 Gain-of-function mutations in the transient receptor potential channels TRPV1 and TRPA1: how painful?
24458144 2014 Increased severity of inflammation correlates with elevated expression of TRPV1 nerve fibers and nerve growth factor on interstitial cystitis/bladder pain syndrome.
24340836 2013 Association of the M3151 variant in the transient receptor potential vanilloid receptor-1 (TRPV1) gene with type 1 diabetes in an Ashkenazi Jewish population.
24312564 2013 Monoacylglycerols activate TRPV1--a link between phospholipase C and TRPV1.
24296694 2013 Capsaicin-sensitive cough receptors in lower airway are responsible for cough hypersensitivity in patients with upper airway cough syndrome.
24275229 2014 Modulation of transient receptor vanilloid 1 activity by transient receptor potential ankyrin 1.
24190005 2014 Epithelial expression of vanilloid and cannabinoid receptors: a potential role in burning mouth syndrome pathogenesis.
24189713 2014 Sensitivity testing in irritable bowel syndrome with rectal capsaicin stimulations: role of TRPV1 upregulation and sensitization in visceral hypersensitivity?
24152419 2015 Increased function of pronociceptive TRPV1 at the level of the joint in a rat model of osteoarthritis pain.
24139494 2014 Capsaicin treatment reduces nasal hyperreactivity and transient receptor potential cation channel subfamily V, receptor 1 (TRPV1) overexpression in patients with idiopathic rhinitis.
24098582 2013 TRPV1 potentiates TGF?-induction of corneal myofibroblast development through an oxidative stress-mediated p38-SMAD2 signaling loop.
24084605 2014 Calcium regulation by temperature-sensitive transient receptor potential channels in human uveal melanoma cells.
24073800 2013 The degradation of airway tight junction protein under acidic conditions is probably mediated by transient receptor potential vanilloid 1 receptor.
24002057 2014 Rhinovirus upregulates transient receptor potential channels in a human neuronal cell line: implications for respiratory virus-induced cough reflex sensitivity.
23902373 2014 Effect of chirality and lipophilicity in the functional activity of evodiamine and its analogues at TRPV1 channels.
23820422 2013 Expression of neuronal markers in the endometrium of women with and those without endometriosis.
23709255 2013 Differential expression and localization of transient receptor potential vanilloid 1 in rabbit and human eyes.
23699529 2013 Mapping the binding site of TRPV1 on AKAP79: implications for inflammatory hyperalgesia.
23689362 2013 TRPV1 gates tissue access and sustains pathogenicity in autoimmune encephalitis.
23616546 2013 Disrupting sensitization of transient receptor potential vanilloid subtype 1 inhibits inflammatory hyperalgesia.
23510405 2015 Expression and functionality of TRPV1 receptor in human MCF-7 and canine CF.41 cells.
23508958 2013 Excitation and modulation of TRPA1, TRPV1, and TRPM8 channel-expressing sensory neurons by the pruritogen chloroquine.
23458684 2013 Role of TRPM2 and TRPV1 cation channels in cellular responses to radiation-induced DNA damage.
23453732 2013 Targeting TRPV1 and TRPV2 for potential therapeutic interventions in cardiovascular disease.
23398938 2013 Opioid withdrawal increases transient receptor potential vanilloid 1 activity in a protein kinase A-dependent manner.
23279936 2013 Effect of cholesterol depletion on the pore dilation of TRPV1.
23264624 2013 Scaffolding by A-kinase anchoring protein enhances functional coupling between adenylyl cyclase and TRPV1 channel.
23183769 2012 Calcium influx through the TRPV1 channel of endothelial cells (ECs) correlates with a stronger adhesion between monocytes and ECs.
23139219 2013 Capsaicin induces NKCC1 internalization and inhibits chloride secretion in colonic epithelial cells independently of TRPV1.
23123284 2013 The role of calcitonin gene-related peptide on the increase in transient receptor potential vanilloid-1 levels in trigeminal ganglion and trigeminal nucleus caudalis activation of rat.
23074220 2012 Human sensory neuron-specific Mas-related G protein-coupled receptors-X1 sensitize and directly activate transient receptor potential cation channel V1 via distinct signaling pathways.
23047628 2012 [Association between genetic variations and functional dyspepsia].
22942745 2012 Binding mode pediction of evodiamine within vanilloid receptor TRPV1.
22936245 2013 Increased expression of TRPV1 in the cortex and hippocampus from patients with mesial temporal lobe epilepsy.
22935106 2013 Study on TRPV1-mediated mechanism for the hypersecretion of mucus in respiratory inflammation.
22883519 2012 [Expression of transient receptor potentials of vanilloid subtype 1 and pain in endometriosis].
22870787 2012 Association between single nucleotide polymorphisms of the transient receptor potential vanilloid 1 (TRPV-1) gene and patients with irritable bowel syndrome in Korean populations.
22829138 2012 Regulation of particulate matter-induced mucin secretion by transient receptor potential vanilloid 1 receptors.
22820645 2012 Neural precursor cells induce cell death of high-grade astrocytomas through stimulation of TRPV1.
22814029 2012 CB2 and TRPV1 receptors mediate cannabinoid actions on MDR1 expression in multidrug resistant cells.
22809607 2012 [Etiology of nonspecific chronic cough in children and relationship between TRPV1 gene polymorphisms and nonspecific chronic cough].
22792722 [Interaction of sea amemone Heteractis crispa Kunitz type polypeptides with pain vanilloid receptor TRPV1: in silico investigation].
22691178 2013 Alteration in TRPV1 and Muscarinic (M3) receptor expression and function in idiopathic overactive bladder urothelial cells.
22647236 2013 Expression of TRPV1 in cortical lesions from patients with tuberous sclerosis complex and focal cortical dysplasia type IIb.
22570472 2012 N-glycosylation determines ionic permeability and desensitization of the TRPV1 capsaicin receptor.
22568077 2012 [Effects of anandamide on IL-11 production through the TRPV1 of human periodontal ligament cells].
22566504 2012 Pulsatile atheroprone shear stress affects the expression of transient receptor potential channels in human endothelial cells.
22556011 2012 The expression and functionality of transient receptor potential vanilloid 1 in ovarian endometriomas.
22518827 2012 Transient receptor potential vanilloid type 1 channels contribute to reflex cutaneous vasodilation in humans.
22493457 2012 Agonist- and Ca2+-dependent desensitization of TRPV1 channel targets the receptor to lysosomes for degradation.
22443337 2012 Transient receptor potential genes, smoking, occupational exposures and cough in adults.
22401740 2012 [Analysis of TRPV1 gene polymorphisms in Spanish patients with neuropathic pain].
22389490 2012 20-Hydroxyeicosatetraenoic acid (20-HETE) is a novel activator of transient receptor potential vanilloid 1 (TRPV1) channel.
22327830 2012 Calcium regulation by thermo- and osmosensing transient receptor potential vanilloid channels (TRPVs) in human conjunctival epithelial cells.
22262885 2012 TRPV1 channels regulate cortical excitability in humans.
22262838 2012 Intact microtubules preserve transient receptor potential vanilloid 1 (TRPV1) functionality through receptor binding.
22260796 2012 Calcineurin is required for TRPV1-induced long-term depression of hippocampal interneurons.
22242698 2012 Inflammatory stimuli up-regulate transient receptor potential vanilloid-1 expression in human bronchial fibroblasts.
22171160 2011 NF-?B feedback control of JNK1 activation modulates TRPV1-induced increases in IL-6 and IL-8 release by human corneal epithelial cells.
22162417 2012 SNP variants within the vanilloid TRPV1 and TRPV3 receptor genes are associated with migraine in the Spanish population.
22089942 2012 Capsaicin-induced inhibition of platelet aggregation is not mediated by transient receptor potential vanilloid type 1.
21981454 2011 TRPV1 and TRPA1 stimulation induces MUC5B secretion in the human nasal airway in vivo.
21962912 2011 TRP-channel-specific cutaneous eicosanoid release patterns.
21960521 2011 ATP: a mediator for HCl-induced TRPV1 activation in esophageal mucosa.
21956871 2012 Confocal microscopy with double immunofluorescence staining reveals the functional transient receptor potential vanilloid subtype 1 expressed in myoepithelial cells of human submandibular glands.
21951314 2012 Effect of mucosal TRPV1 inhibition in allergic rhinitis.
21945155 2012 Thermo-sensitive transient receptor potential vanilloid channel-1 regulates intracellular calcium and triggers chromogranin A secretion in pancreatic neuroendocrine BON-1 tumor cells.
21926175 2011 C-terminal dimerization activates the nociceptive transduction channel transient receptor potential vanilloid 1.
21911503 2011 The chimeric approach reveals that differences in the TRPV1 pore domain determine species-specific sensitivity to block of heat activation.
21654202 Dissecting TRPV1: lessons to be learned?
21616913 2011 The Ile585Val TRPV1 variant is involved in risk of painful knee osteoarthritis.
21555515 2011 Identification of a binding motif in the S5 helix that confers cholesterol sensitivity to the TRPV1 ion channel.
21546516 2011 The 57 kb deletion in cystinosis patients extends into TRPV1 causing dysregulation of transcription in peripheral blood mononuclear cells.
21506114 2011 Thermosensitive transient receptor potential channels in human corneal epithelial cells.
21493704 2011 Molecular mechanisms of activation of endothelial nitric oxide synthase mediated by transient receptor potential vanilloid type 1.
21451044 2011 Trpv1 reporter mice reveal highly restricted brain distribution and functional expression in arteriolar smooth muscle cells.
21351130 2011 Increased transient receptor potential vanilloid type 1 (TRPV1) signaling in idiopathic overactive bladder urothelial cells.
21345654 2011 TRPV1 antagonist can suppress the atopic dermatitis-like symptoms by accelerating skin barrier recovery.
21310942 2011 Capsaicin promotes a more aggressive gene expression phenotype and invasiveness in null-TRPV1 urothelial cancer cells.
21285946 2011 The biophysical and molecular basis of TRPV1 proton gating.
21168271 2011 Human odontoblasts express functional thermo-sensitive TRP channels: implications for dentin sensitivity.
21160085 2011 TRPV1 expression on peritoneal endometriosis foci is associated with chronic pelvic pain.
21083604 2010 Expression of transient receptor potential vanilloid-1 (TRPV1) in urothelial cancers of human bladder: relation to clinicopathological and molecular parameters.
21076424 2010 Postsynaptic TRPV1 triggers cell type-specific long-term depression in the nucleus accumbens.
21076423 2010 TRPV1 activation by endogenous anandamide triggers postsynaptic long-term depression in dentate gyrus.
21044960 2010 Conserved residues within the putative S4-S5 region serve distinct functions among thermosensitive vanilloid transient receptor potential (TRPV) channels.
21037510 2011 Association of somatoform disorder symptoms with genetic variants potentially involved in the modulation of nociception.
20807792 2010 Transient receptor potential vanilloid type-1 (TRPV-1) channels contribute to cutaneous thermal hyperaemia in humans.
20696376 2010 The role of the TRP channel NompC in Drosophila larval and adult locomotion.
20691059 2010 Impact of central and peripheral TRPV1 and ROS levels on proinflammatory mediators and nociceptive behavior.
20639579 2010 Loss of function of transient receptor potential vanilloid 1 (TRPV1) genetic variant is associated with lower risk of active childhood asthma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20518854 2010 Evidence for neurotrophic factors associating with TRPV1 gene expression in the inflamed human esophagus.
20515731 2010 TRPV1 splice variants: structure and function.
20456759 2010 Increased TRPV1 gene expression in esophageal mucosa of patients with non-erosive and erosive reflux disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351268 2010 Thermosensitive TRP channel pore turret is part of the temperature activation pathway.
20190512 2010 [Activation and regulation of nociceptive transient receptor potential (TRP) channels, TRPV1 and TRPA1].
20145248 2010 Distinct modulations of human capsaicin receptor by protons and magnesium through different domains.
20096818 2010 Immunoreactivity of oxytocin receptor and transient receptor potential vanilloid type 1 and its correlation with dysmenorrhea in adenomyosis.
20060270 2010 Glycolic acid induces keratinocyte proliferation in a skin equivalent model via TRPV1 activation.
20034385 2009 Polymorphisms in gene encoding TRPV1-receptor involved in pain perception are unrelated to chronic pancreatitis.
19959817 2010 Signaling in TRPV1-induced platelet activating factor (PAF) in human esophageal epithelial cells.
19923855 2010 Upregulation of transient receptor potential vanilloid type-1 receptor expression in oral lichen planus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19877503 2009 [TRPV1 UTR-3 polymorphism and susceptibility of childhood asthma of the Han Nationality in Beijing].
19801576 2010 PRKCSH/80K-H, the protein mutated in polycystic liver disease, protects polycystin-2/TRPP2 against HERP-mediated degradation.
19778904 2009 The endoplasmic reticulum of dorsal root ganglion neurons contains functional TRPV1 channels.
19770677 2010 Homozygous TRPV1 315C influences the susceptibility to functional dyspepsia.
19749171 2009 The transient receptor potential vanilloid-1 channel in thermoregulation: a thermosensor it is not.
19656659 2009 Endogenous expression of TRPV1 channel in cultured human melanocytes.
19651168 2009 TRPV1 expression and activity during retinoic acid-induced neuronal differentiation.
19619644 2009 Up-regulation of TRPV1 in mononuclear cells of end-stage kidney disease patients increases susceptibility to N-arachidonoyl-dopamine (NADA)-induced cell death.
19608651 2009 Characterization of the endocannabinoid system in human spermatozoa and involvement of transient receptor potential vanilloid 1 receptor in their fertilizing ability.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19482060 2009 Transient receptor potential vanilloid 1, vanilloid 2 and melastatin 8 immunoreactive nerve fibers in human skin from individuals with and without Norrbottnian congenital insensitivity to pain.
19397909 2009 Transient receptor potential vanilloid-1 signaling inhibits differentiation and activation of human dendritic cells.
19333172 Increased capsaicin receptor TRPV1 in the peritoneum of women with chronic pelvic pain.
19328632 2009 TRPV1: a potential target for antiepileptogenesis.
19161409 2009 Increased expression of TRPV1 channel in intrinsically aged and photoaged human skin in vivo.
19074743 2008 Breathtaking TRP channels: TRPA1 and TRPV1 in airway chemosensation and reflex control.
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
19036069 2009 A role for TRPV1 in agonist-evoked activation of human platelets.
18983665 2008 Quantitative Real-Time PCR detection of TRPV1-4 gene expression in human leukocytes from healthy and hyposensitive subjects.
18852901 2008 Human keratinocytes are vanilloid resistant.
18830626 2009 Increased expressions of cannabinoid receptor-1 and transient receptor potential vanilloid-1 in human prostate carcinoma.
18791833 2008 Molecular modeling of the full-length human TRPV1 channel in closed and desensitized states.
18787888 2008 Functional expression of transient receptor potential vanilloid-related channels in chronically hypoxic human pulmonary arterial smooth muscle cells.
18786439 2008 High expression of vanilloid receptor-1 is associated with better prognosis of patients with hepatocellular carcinoma.
18769453 2009 Transient receptor potential vanilloid-1 signaling as a regulator of human sebocyte biology.
18584893 2008 Transient receptor potential vanilloid 1-mediated expression and secretion of endothelial cell-derived calcitonin gene-related peptide.
18574245 2008 Determinants of molecular specificity in phosphoinositide regulation. Phosphatidylinositol (4,5)-bisphosphate (PI(4,5)P2) is the endogenous lipid regulating TRPV1.
18559878 2008 Identification of molecular determinants of channel gating in the transient receptor potential box of vanilloid receptor I.
18552442 2008 [Transient receptor potential (TRP) channel and cough].
18503554 2008 Heat-induced MMP-1 expression is mediated by TRPV1 through PKCalpha signaling in HaCaT cells.
18499726 2008 Relative contributions of TRPA1 and TRPV1 channels in the activation of vagal bronchopulmonary C-fibres by the endogenous autacoid 4-oxononenal.
18482991 2008 Rapid, opioid-sensitive mechanisms involved in transient receptor potential vanilloid 1 sensitization.
18414789 2008 Cytosine arabinoside affects the heat and capsaicin receptor TRPV1 localisation and sensitivity in human sensory neurons.
18267041 2008 Influence of pregnancy and labor on the occurrence of nerve fibers expressing the capsaicin receptor TRPV1 in human corpus and cervix uteri.
18230619 2008 Novel gating and sensitizing mechanism of capsaicin receptor (TRPV1): tonic inhibitory regulation of extracellular sodium through the external protonation sites on TRPV1.
18222434 2008 Transient receptor potential vanilloid receptor-1 confers heat resistance to male germ cells.
18076848 2007 Pulpal expression of TRPV1 in molar incisor hypomineralisation.
17927589 2007 Epidermal transient receptor potential vanilloid 1 in idiopathic small nerve fibre disease, diabetic neuropathy and healthy human subjects.
17913835 2007 Functional effects of nonsynonymous polymorphisms in the human TRPV1 gene.
17659837 2007 The effects of the TRPV1 antagonist SB-705498 on TRPV1 receptor-mediated activity and inflammatory hyperalgesia in humans.
17626206 2007 Nonthermal activation of transient receptor potential vanilloid-1 channels in abdominal viscera tonically inhibits autonomic cold-defense effectors.
17596456 2007 Dual regulation of TRPV1 by phosphoinositides.
17582772 2007 Burning mouth syndrome as a trigeminal small fibre neuropathy: Increased heat and capsaicin receptor TRPV1 in nerve fibres correlates with pain score.
17567713 2007 Artificial sweeteners and salts producing a metallic taste sensation activate TRPV1 receptors.
17560936 2007 Expression of transient receptor potential vanilloid 1 (TRPV1) in synovial fibroblasts from patients with osteoarthritis and rheumatoid arthritis.
17521436 2007 Differential expression of the capsaicin receptor TRPV1 and related novel receptors TRPV3, TRPV4 and TRPM8 in normal human tissues and changes in traumatic and diabetic neuropathy.
17508360 2007 Transient receptor potential vanilloid 1 activation induces inflammatory cytokine release in corneal epithelium through MAPK signaling.
17508023 2007 Transient receptor potential vanilloid-1 mediates heat-shock-induced matrix metalloproteinase-1 expression in human epidermal keratinocytes.
17442052 2007 Activation of recombinant human TRPV1 receptors expressed in SH-SY5Y human neuroblastoma cells increases [Ca(2+)](i), initiates neurotransmitter release and promotes delayed cell death.
17442041 2007 Capsaicin-induced apoptosis of glioma cells is mediated by TRPV1 vanilloid receptor and requires p38 MAPK activation.
17428642 2007 The role of Transient Receptor Potential Vanilloid 1 (TRPV1) channels in pancreatitis.
17392452 2007 The vanilloid receptor TRPV1 is tonically activated in vivo and involved in body temperature regulation.
17385724 2007 Insulin and insulin-like growth factor type-I up-regulate the vanilloid receptor-1 (TRPV1) in stably TRPV1-expressing SH-SY5Y neuroblastoma cells.
17347480 2007 Activation of transient receptor potential vanilloid type-1 channel prevents adipogenesis and obesity.
17217056 2007 Capsaicin receptor: TRPV1 a promiscuous TRP channel.
17184838 2007 A novel function of capsaicin-sensitive TRPV1 channels: involvement in cell migration.
17176640 A nonpungent component of steamed ginger--[10]-shogaol--increases adrenaline secretion via the activation of TRPV1.
17109831 2007 Vanilloid receptor 1 (TRPV1) expression in lingual nerve neuromas from patients with or without symptoms of burning pain.
17074976 2006 Phosphoinositide 3-kinase binds to TRPV1 and mediates NGF-stimulated TRPV1 trafficking to the plasma membrane.
17018028 2006 TRPV1b overexpression negatively regulates TRPV1 responsiveness to capsaicin, heat and low pH in HEK293 cells.
17016800 2007 The molecular basis of urgency: regional difference of vanilloid receptor expression in the human urinary bladder.
16996800 2006 TRPV1: a therapeutic target for novel analgesic drugs?
16996476 2006 Silencing of vanilloid receptor TRPV1 by RNAi reduces neuropathic and visceral pain in vivo.
16842630 2006 The mu opioid agonist morphine modulates potentiation of capsaicin-evoked TRPV1 responses through a cyclic AMP-dependent protein kinase A pathway.
16793902 2006 Protease-activated receptor 2 sensitizes TRPV1 by protein kinase Cepsilon- and A-dependent mechanisms in rats and mice.
16777226 2007 Expression of transient receptor potential vanilloid 1 (TRPV1) and 2 (TRPV2) in human peripheral blood.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16406364 2006 First "hybrid" ligands of vanilloid TRPV1 and cannabinoid CB2 receptors and non-polyunsaturated fatty acid-derived CB2-selective ligands.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16381901 2006 The LIFEdb database in 2006.
16319926 2005 NGF rapidly increases membrane expression of TRPV1 heat-gated ion channels.
16301147 2005 Expression of capsaicin receptor TRPV-1 in synovial tissues of patients with symptomatic internal derangement of the temporomandibular joint and joint pain.
16099171 2005 Gadolinium activates and sensitizes the vanilloid receptor TRPV1 through the external protonation sites.
16081411 2005 Endogenous unsaturated C18 N-acylethanolamines are vanilloid receptor (TRPV1) agonists.
15992990 2005 Transient receptor potential vanilloid type 1 (TRPV1) expression changes from normal urothelium to transitional cell carcinoma of human bladder.
15793280 2005 A hot new twist to hair biology: involvement of vanilloid receptor-1 (VR1/TRPV1) signaling in human hair growth control.
15738111 2005 Coexpression of vanilloid receptor subtype-1 and acid-sensing ion channel genes in the human trigeminal ganglion neurons.
15708075 2005 Capsaicin receptor TRPV1 in urothelium of neurogenic human bladders and effect of intravesical resiniferatoxin.
15691846 2005 Regulation of Ca2+-dependent desensitization in the vanilloid receptor TRPV1 by calcineurin and cAMP-dependent protein kinase.
15685214 2005 Effects of piperine, the pungent component of black pepper, at the human vanilloid receptor (TRPV1).
15644492 2005 TRPV1b, a functional human vanilloid receptor splice variant.
15574747 2004 Acid-induced pain and its modulation in humans.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15306801 2004 The principle of temperature-dependent gating in cold- and heat-sensitive TRP channels.
15190102 2004 Identification of a tetramerization domain in the C terminus of the vanilloid receptor.
15066994 2004 Regulated exocytosis contributes to protein kinase C potentiation of vanilloid receptor activity.
15051629 2004 Activation and sensitisation of the vanilloid receptor: role in gastrointestinal inflammation and function.
14996838 2004 Molecular determinants of vanilloid sensitivity in TRPV1.
14987252 2004 Expression of vanilloid receptor subtype 1 in cutaneous sensory nerve fibers, mast cells, and epithelial cells of appendage structures.
14630912 2004 Phosphorylation of vanilloid receptor 1 by Ca2+/calmodulin-dependent kinase II regulates its vanilloid binding.
14554100 2003 Vanilloid receptor activation by 2- and 10-microm particles induces responses leading to apoptosis in human airway epithelial cells.
14523239 2003 Protein kinase C phosphorylation sensitizes but does not activate the capsaicin receptor transient receptor potential vanilloid 1 (TRPV1).
14520770 2003 Capsaicin receptor VR1 and ATP purinoceptor P2X3 in painful and nonpainful human tooth pulp.
14506258 2003 Desensitization of capsaicin-activated currents in the vanilloid receptor TRPV1 is decreased by the cyclic AMP-dependent protein kinase pathway.
12812762 2003 A tyrosine residue in TM6 of the Vanilloid Receptor TRPV1 involved in desensitization and calcium permeability of capsaicin-activated currents.
12808128 2003 Structural determinant of TRPV1 desensitization interacts with calmodulin.
12765698 Role and regulation of TRP channels in neutrophil granulocytes.
12721390 2003 Capsaicinoids cause inflammation and epithelial cell death through activation of vanilloid receptors.
12573376 2003 Sensory fibres expressing capsaicin receptor TRPV1 in patients with rectal hypersensitivity and faecal urgency.
12490594 2003 Activation of epidermal vanilloid receptor-1 induces release of proinflammatory mediators in human keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454015 2003 Versatile regulation of cytosolic Ca2+ by vanilloid receptor I in rat dorsal root ganglion neurons.
12393854 2002 Amiloride-blockable acid-sensing ion channels are leading acid sensors expressed in human nociceptors.
12194871 2002 cAMP-dependent protein kinase regulates desensitization of the capsaicin receptor (VR1) by direct phosphorylation.
12077606 2002 TRPV3 is a temperature-sensitive vanilloid receptor-like protein.
11884385 2002 Direct phosphorylation of capsaicin receptor VR1 by protein kinase Cepsilon and identification of two target serine residues.
11549313 2001 The genomic organization of the gene encoding the vanilloid receptor: evidence for multiple splice variants.
11358970 2001 Analysis of the native quaternary structure of vanilloid receptor 1.
11243859 2001 The tissue distribution and functional characterization of human VR1.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11226139 2001 Pharmacological differences between the human and rat vanilloid receptor 1 (VR1).
11124944 2001 Ligand-induced dynamic membrane changes and cell deletion conferred by vanilloid receptor 1.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11050376 2000 Cloning and functional expression of a human orthologue of rat vanilloid receptor-1.
10725386 2000 Distribution of mRNA for vanilloid receptor subtype 1 (VR1), and VR1-like immunoreactivity, in the central nervous system of the rat and human.
10201375 1999 A capsaicin-receptor homologue with a high threshold for noxious heat.
9349813 1997 The capsaicin receptor: a heat-activated ion channel in the pain pathway.