Property Summary

NCBI Gene PubMed Count 114
PubMed Score 328.60
PubTator Score 249.19

Knowledge Summary

Patent (11,925)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.095 9.7e-03
atypical teratoid/rhabdoid tumor 1.300 9.2e-05
sonic hedgehog group medulloblastoma 1.100 1.0e-03

 GWAS Trait (1)

Gene RIF (97)

PMID Text
27020697 TRPM7 dysfunction may cause macrothrombocytopenia in humans and mice.
26780729 These results suggest that TRPM7 channel may play a critical role for zinc toxicity associated with stress.
26563869 Data show that resistant cells express lower amounts of the transient receptor potential cation channel subfamily M TRPM6 and 7, both involved in magnesium transport.
26179995 The Different Roles of The Channel-Kinases TRPM6 and TRPM7
25983327 When TRPM7 channel expression was induced from HEK293 cells in a nutrient-rich condition, LC3-II level increased indicating the increased level of basal autophagy.
25946314 TRPM7 inhibition by siRNA caused an increase in adhesion relative to control, but a decrease to 80% of calcium response relative to non-targeting siRNA which confirms the important role of TRPM7 in mechanotransduction despite the increase in adhesion.
25797249 TRPM7 expression closely associates with the migratory and metastatic properties of neuroblastoma cells in vitro and in vivo. TRPM7 controls a developmental transcriptional program involving the transcription factor SNAI2.
25472964 Data suggest that the TRPM7 channel negatively regulates the function of vascular endothelial cells.
25438992 Study demonstrates that human glioma cells express functional TRPM7 channel and that activation of this channel plays an important role in the proliferation, migration, and invasion of malignant glioma cells
25304381 High TRPM7 expression is associated with nasopharyngeal carcinoma.
25277194 N-Myc can promote neuroblastoma cell proliferation through up-regulation of the channel kinases TRPM6 and TRPM7
25263397 These results identified a central role of TRPM7 in MSC mechanical stimulation-induced osteogenesis
25192910 TRPM7 activates JAK2/STAT3 and/or Notch signaling pathways and leads to increased cell proliferation and migration.
25130439 Data show that lipopolysaccharide induced vascular endothelial cell migration is mediated by toll-like receptor TLR-4/NF-kappa B pathway and enzyme NAD(P)H oxidase in association with the transient receptor potential melastatin 7 (TRPM7) ion channel.
25069584 TRPM7 has been associated with cell proliferation, survival and development and thus correlated with growth and progression of several types of tumor cells
24952306 The TRPM7 single-nucleotide polymorphisms (rs8042919 and rs7173321) are associated with breast cancer in Han Population of Northeast China.
24935580 Overexpression of TRPM7 expression is significantly associated with poor prognosis in patients with ovarian cancer.
24858416 Data indicate heteromer formation between channel kinases TRPM6 and TRPM7 influences the biological activity of the ion channels.
24855944 Study shows that in normal tissues and cell lines, the kinase is proteolytically cleaved from the channel domain in a cell-type-specific manner. These TRPM7 cleaved kinase fragments (M7CKs) translocate to the nucleus and bind multiple components of chromatin-remodeling complexes, including Polycomb group proteins.
24769209 TRPM7 could be essential for initiation and/or progression of prostate cancer.
24710004 TRPM7 is a key protein involved in the mechanism underlying endotoxin-induced endothelial fibrosis
24445362 Characterized the spatiotemporal evolution of intracellular calcium 'flickers', a signature of cell activation, in response to steady, pulsatile, and oscillatory shear stress, related to the opening of a stretch activated ion channel, TRPM7.
24385424 TRPM6 modulates the functionality of TRPM7, and the TRPM6 kinase plays a critical role in tuning the phenotype of the TRPM7.M6 channel complex.
24223965 TRPM7 channels play an important role in hyperglycemia-induced injury of vascular endothelial cells
24138320 TRPM7 was involved in the regulation of hDPSC proliferation, migration and osteogenic differentiation and may play a role in the dental pulp repair process
23934071 Human lung fibroblasts express functional TRPM7 channels that may play a vital role in modulating cell proliferation and differentiation, probably involved in the PI3K/Akt pathway.
23838006 TRPM7 alpha-kinase modulates inflammatory signaling by aldosterone in a TRPM7 channel/ Mg2+-independent manner.
23533657 Results indicate that TRPM7 modulates endothelial behavior and that any condition leading to TRPM7 upregulation might impair endothelial function.
23471296 TRPM7 may contribute to the anti-proliferative characteristics of intracellular iodide accumulation in cancer cells.
23353055 TRPM7 regulates migration and invasion of metastatic breast cancer cells via MAPK pathway.
23247582 TRPM7 is implicated in ischemia-related neuronal death. [review]
23168410 an increase in serum Ca2+/Mg2+ ratio promotes proliferation of prostate cancer cells by activating TRPM7 channels
22871386 Findings suggest that TRPM7 is part of a mechanosensory complex adopted by cancer cells to drive metastasis formation in breast cancer.
22820907 TRPM7 is one of the important nonglutamate mechanisms in stroke, which has been evaluated in both in-vitro and in-vivo. [review]
22802050 TRPM7 channels are present in human atrial myocytes, and the channel expression is upregulated in the atria with atrial fibrillation.
22759789 TRPM7-kinase phosphorylates PLCgamma2 in its C2-domain at position Ser1164 and in the linker region preceding the C2-domain at position Thr1045.
22698280 It was shown that TRPM7 regulates endocytic compartmentalization of the Fas receptor after receptor stimulation, an important process for apoptotic signaling.
22671428 Alteration in the expression and/or activity of magnesium channels is a frequent finding in cancer cells.
22634382 Studies indicate functional roles of TRPM7 in neurological and cardiovascular disease.
22566504 Data show the expression of TRPC6 and TRPV1 was significantly increased after 24 hours of exposure to an atheroprone flow, whereas the expression of TRPC3 and TRPM7 was significantly higher in endothelial cells exposed to shear stress.
22460708 TRPM7 channel shows two conductance levels and both are reversibly inhibited by internal Mg(2+). Mg(2+) sensitivity of the channel is a dynamic characteristic that depends on other membrane factors.
22323115 TRPM7 is involved in the BxPC-3 cell migration via a Mg(2+)-dependent mechanism.
22308955 TRPM7 has an important role in the growth and survival of gastric cancer cells and is a likely potential target for the pharmacological treatment of gastric cancer.
22301056 Present data on amplitude distribution of preactivated TRPM7 currents in Jurkat T lymphocytes in the absence of prior Mg(2+) or proton depletion.
22183257 These results point to magnesium and TRPM7 as a modulators of the angiogenic phenotype of microvascular endothelial cells.
22102510 TRPM7 may underlie the Ca(2+) entry deficits observed in Familial Alzheimer disease-associated presenilin mutants and suggest that the normal function of presenilin involves regulation of TRPM7 through a PIP2-dependent mechanism
21926172 Waixenicin A inhibits cell proliferation through magnesium-dependent block of transient receptor potential melastatin 7 (TRPM7) channels.
21627970 Data show that gene expression of the Mg(2+) selective transporter MagT1 is upregulated in TRPM7(-/-) cells.
21443732 TRPM7 channels may play an important role in the survival of gastric cancer.
21183474 Trpm7 regulates exocrine pancreatic development via the Mg(2+)-sensitive Socs3a pathway.
21150127 Vascular TRPM7 is a signaling kinase involved in vascular smooth muscle cell growth, apoptosis, adhesion, contraction, cytoskeletal organization & migration. It is modulated by vasoactive agents, pressure, stretch & osmotic changes. Review.
21122141 Data report that a synthetic serine protease inhibitor, nafamostat mesylate (NM), and several of its analogues, block TRPM7 currents in inverse relationship to the concentration of extracellular divalent cations.
21112387 TRPM7's structural duality ensures ideal positioning of its kinase in close proximity to channel-mediated Mg(2+) uptake, allowing for the adjustment of protein translational rates to the availability of Mg(2+).
20875900 The present investigation further suggests that TRPM6 and TRPM7 gene variation may not be useful predictors for type 2 diabetes mellitus risk assessment.
20875900 Observational study of gene-disease association. (HuGE Navigator)
20075334 Results establish that TRPM7 is the major Ca(2+)-permeable channel in human atrial fibroblasts and likely plays an essential role in TGF-beta1-elicited fibrogenesis in human atrial fibrillation.
20070945 excessive TRPM7 channel activity causes oxidative and nitrosative stresses, producing cell rounding mediated by p38 MAPK/JNK-dependent activation of m-calpain
19998500 These results suggest that the human GI tract generates slow waves and that TRPM7 channels expressed in the interstitial cells of Cajal may be involved in the generation of the slow waves.
19644062 no evidence of a role for the TRPM7 gene in the risk of incident ischemic stroke.
19644062 Observational study of gene-disease association. (HuGE Navigator)
19515901 These findings strongly suggest that TRPM7 is involved in the proliferative potentiality of breast cancer cells, probably by regulating Ca(2+) influx.
19454490 Silencing TRPM7 promotes growth/proliferation and nitric oxide production of vascular endothelial cells via the ERK pathway.
19405049 results indicate that TRPM7 is not associated with ALS/PDC in the Kii peninsula of Japan
19405049 Observational study of gene-disease association. (HuGE Navigator)
19149903 there was no evidence of association between common TRPM7 haplotypes and diabetes risk
19149903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19145781 bradykinin regulates TRPM7 and its downstream target annexin-1 through phospholipase C-dependent, protein kinase C-dependent and c-Src-dependent and cAMP-independent pathways.
19032368 Suppression of TRPM7 induces cell death in gastric cancer.
18826101 TRPM7 is present in human head and neck squamous carcinoma cells. siRNA silencing of TRPM7 inhibited the growth and proliferation of these cells.
18719395 in human TRPM7, both Asp-1054 and Glu-1052, may provide binding sites for Mg(2+) and Ca(2+); Asp-1054 is an essential determinant of Mg(2+)and Ca(2+) conductivity; Glu-1052 and Asp-1059 facilitate conduction of divalent cations
18675813 TRPM6 and TRPM7 phosphorylate the assembly domain of myosin IIA, IIB and IIC on identical residues.
18390554 proton conductivity of endogenous human TRPM7 plays a role in physiologically/pathologically acidic situations.
18365021 findings support a model where massive autophosphorylation outside the catalytic domain of TRPM6 and TRPM7 may facilitate kinase-substrate interactions leading to enhanced phosphorylation of those substrates
18301276 The predominant Mg transporters include TRPM6 and TRPM7
18192217 This review discusses the importance of magnesium in vascular biology and implications in hypertension and highlights the transport systems, particularly TRPM7--REVIEW
18073331 restoration of only two "ancient" pore residues in human TRPM2 (Q981E/P983Y) significantly increased (approximately 4-fold) its permeability for Ca(2+).
18006838 Transient receptor potential melastatin 7-like current has a role in cell proliferation in human head and neck carcinoma cells
17823441 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17823441 The subjects who carried >or=1 1482Ile allele and who consumed diets with a high Ca:Mg intake were at a higher risk of adenoma and hyperplastic polyps than were the subjects who did not carry the polymorphism
17785843 Human mast cells express functional TRPM7 channels that are a critical requirement for cell survival.
17646711 The inner membrane potential (as regulated by proton ionophores) and the F1/FO-ATP synthase of mitochondria are important in regulating TRPM7 channels.
17510191 TRPM7 senses osmotically induced changes primarily through molecular crowding of solutes that affect channel activity.
17310095 We thus conclude that the TRPM7 channel can be directly activated by mechano-stress in a manner independent of exocytosis-mediated incorporation of this channel protein into the plasma membrane.
17217066 the channel may serve as a regulated transport mechanism for these ions that could affect cell adhesion, cell growth and proliferation, and even cell death under pathological stress such as anoxia--{REVIEW}
17095511 under physiological ionic conditions, TRPM7 currents are activated rather than inhibited by PLC-activating receptor agonists
16943238 TRPM7 is stretch- and swelling-activated cation channel endogenously expressed in HeLa cells. By serving as swelling-induced Ca(2+) influx pathway, it has important role in cell volume regulation.
16636202 heterologous expression of TRPM6 but not the mutant TRPM6(S141L) produces functional channels with divalent cation permeability profile and pH sensitivity distinctive from those of TRPM7 channels and TRPM6/7 complexes
16533898 We conclude that the nucleotide-dependent regulation of TRPM7 is mediated by the nucleotide binding site on the channel's endogenous kinase domain and interacts synergistically with a Mg(2+) binding site extrinsic to that domain.
16436382 the ion channel TRPM7 regulates cell adhesion through m-calpain by mediating the local influx of calcium into peripheral adhesion complexes
16407977 Regulation of cell adhesion by TRPM7 is the combined effect of kinase-dependent and -independent pathways on actomyosin contractility.
16357306 Both endogenous and heterologously expressed TRPM7 was found in tubulovesicular structures that were translocated to the region of the plasma membrane on induction of shear stress.
16150690 Although TRPM6 and TRPM7 are closely related and deficiency in either one of these molecules severely affects Mg(2+) homeostasis regulation, TRPM6 and TRPM7 do not appear to be functionally redundant.
16075242 TRPM7-deficient cells become Mg(2+) deficient & are not viable.TRPM7 is characterized functionally as constitutively active ion channel permeable for variety of cations including Ca & Mg & regulated by intracellular Mg &/or Mg-nucleotide complexes[review]
16051700 A TRPM7 variant shows altered sensitivity to magnesium that may contribute to the pathogenesis of two Guamanian neurodegenerative disorders.
15591230 TRPM7 is a functionally important regulator of Mg2+ homeostasis and growth in vascular smooth muscle cells.
15069188 TRPM7 activity is up- and down-regulated through its endogenous kinase in a cAMP- and protein kinase A-dependent manner
14594813 only Mg(2+) can directly modulate TRPM7/ChaK1 kinase activity in vivo

AA Sequence

MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDH      1 - 70
FNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVH     71 - 140
GGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVI    141 - 210
ENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIG    211 - 280
QGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTI    281 - 350
KKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRV    351 - 420
DIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLF    421 - 490
HLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRK    491 - 560
SHESFGNRADKKEKMRHNHFIKTAQPYRPKIDTVMEEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWAC    561 - 630
LMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQ    631 - 700
DETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPA    701 - 770
ILLLEYKTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLP    771 - 840
ITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEKVREIFMSEAG    841 - 910
KVNQKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWYVRLLDFL    911 - 980
AVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLAKDIVFHPYWMIFGEVYA    981 - 1050
YEIDVCANDSVIPQICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIM   1051 - 1120
AYHEKPVLPPPLIILSHIVSLFCCICKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFH   1121 - 1190
SGSEERIRVTFERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV   1191 - 1260
HNEITRELSISKHLAQNLIDDGPVRPSVWKKHGVVNTLSSSLPQGDLESNNPFHCNILMKDDKDPQCNIF   1261 - 1330
GQDLPAVPQRKEFNFPEAGSSSGALFPSAVSPPELRQRLHGVELLKIFNKNQKLGSSSTSIPHLSSPPTK   1331 - 1400
FFVSTPSQPSCKSHLETGTKDQETVCSKATEGDNTEFGAFVGHRDSMDLQRFKETSNKIKILSNNNTSEN   1401 - 1470
TLKRVSSLAGFTDCHRTSIPVHSKQAEKISRRPSTEDTHEVDSKAALIPDWLQDRPSNREMPSEEGTLNG   1471 - 1540
LTSPFKPAMDTNYYYSAVERNNLMRLSQSIPFTPVPPRGEPVTVYRLEESSPNILNNSMSSWSQLGLCAK   1541 - 1610
IEFLSKEEMGGGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVVNTWSSIYKEDTVLHLCLREIQQQRA   1611 - 1680
AQKLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTNTLEEIMLA   1681 - 1750
FSHWTYEYTRGELLVLDLQGVGENLTDPSVIKAEEKRSCDMVFGPANLGEDAIKNFRAKHHCNSCCRKLK   1751 - 1820
LPDLKRNDYTPDKIIFPQDEPSDLNLQPGNSTKESESTNSVRLML                            1821 - 1865
//

Text Mined References (119)

PMID Year Title
27020697 2016 Defects in TRPM7 channel function deregulate thrombopoiesis through altered cellular Mg(2+) homeostasis and cytoskeletal architecture.
26780729 2016 Stress hormone potentiates Zn(2+)-induced neurotoxicity via TRPM7 channel in dopaminergic neuron.
26563869 2015 Magnesium homeostasis in colon carcinoma LoVo cells sensitive or resistant to doxorubicin.
26179995 2015 The Different Roles of The Channel-Kinases TRPM6 and TRPM7.
25983327 2015 Regulation of basal autophagy by transient receptor potential melastatin 7 (TRPM7) channel.
25946314 2015 Rapid and Localized Mechanical Stimulation and Adhesion Assay: TRPM7 Involvement in Calcium Signaling and Cell Adhesion.
25797249 2015 TRPM7 maintains progenitor-like features of neuroblastoma cells: implications for metastasis formation.
25472964 2015 TRPM7 regulates vascular endothelial cell adhesion and tube formation.
25438992 2015 Suppression of TRPM7 inhibits proliferation, migration, and invasion of malignant human glioma cells.
25304381 2015 TRPM7 promotes the metastatic process in human nasopharyngeal carcinoma.
25277194 2014 N-Myc-induced up-regulation of TRPM6/TRPM7 channels promotes neuroblastoma cell proliferation.
25263397 2015 Brief reports: TRPM7 Senses mechanical stimulation inducing osteogenesis in human bone marrow mesenchymal stem cells.
25192910 2014 TRPM7 channels regulate glioma stem cell through STAT3 and Notch signaling pathways.
25130439 2014 Endotoxin-induced vascular endothelial cell migration is dependent on TLR4/NF-?B pathway, NAD(P)H oxidase activation, and transient receptor potential melastatin 7 calcium channel activity.
25069584 2014 Oncogenic role and therapeutic target of transient receptor potential melastatin 7 channel in malignancy.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24952306 2014 The association between single-nucleotide polymorphisms of TRPM7 gene and breast cancer in Han Population of Northeast China.
24938632 2014 Epigenetics: the TRPM7 ion channel modifies histones.
24935580 2014 Overexpression of TRPM7 is associated with poor prognosis in human ovarian carcinoma.
24920677 2014 Flow shear stress enhances intracellular Ca2+ signaling in pulmonary artery smooth muscle cells from patients with pulmonary arterial hypertension.
24858416 2014 TRPM6 kinase activity regulates TRPM7 trafficking and inhibits cellular growth under hypomagnesic conditions.
24855944 2014 The TRPM7 chanzyme is cleaved to release a chromatin-modifying kinase.
24849279 2014 Potential role of transient receptor potential (TRP) channels in bladder cancer cells.
24769209 2014 Cholesterol-induced activation of TRPM7 regulates cell proliferation, migration, and viability of human prostate cells.
24756720 2014 TRPM7.
24752033 The channel-kinase TRPM7, revealing the untold story of Mg(2+) in cellular signaling.
24710004 2014 Endotoxin induces fibrosis in vascular endothelial cells through a mechanism dependent on transient receptor protein melastatin 7 activity.
24445362 2014 Oscillatory shear stress induced calcium flickers in osteoblast cells.
24385424 2014 The TRPM6 kinase domain determines the Mg·ATP sensitivity of TRPM7/M6 heteromeric ion channels.
24316671 2014 Plasma membrane translocation of trimerized MLKL protein is required for TNF-induced necroptosis.
24223965 2013 Role of TRPM7 channels in hyperglycemia-mediated injury of vascular endothelial cells.
24138320 2014 The effect of TRPM7 suppression on the proliferation, migration and osteogenic differentiation of human dental pulp stem cells.
23934071 2013 Inhibition of TRPM7 channels prevents proliferation and differentiation of human lung fibroblasts.
23838006 2013 Aldosterone signaling through transient receptor potential melastatin 7 cation channel (TRPM7) and its ?-kinase domain.
23533657 2013 Regulation and function of TRPM7 in human endothelial cells: TRPM7 as a potential novel regulator of endothelial function.
23471296 2013 TRPM7 is regulated by halides through its kinase domain.
23353055 2013 TRPM7 mediates breast cancer cell migration and invasion through the MAPK pathway.
23247582 2013 TRPM7, the cytoskeleton and neuronal death.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23168410 2013 Increase in serum Ca2+/Mg2+ ratio promotes proliferation of prostate cancer cells by activating TRPM7 channels.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22871386 2012 TRPM7 is required for breast tumor cell metastasis.
22820907 2013 Current understanding of TRPM7 pharmacology and drug development for stroke.
22802050 2012 Evidence for functional expression of TRPM7 channels in human atrial myocytes.
22759789 2012 Identification of Ser/Thr phosphorylation sites in the C2-domain of phospholipase C ?2 (PLC?2) using TRPM7-kinase.
22698280 2012 Cleavage of TRPM7 releases the kinase domain from the ion channel and regulates its participation in Fas-induced apoptosis.
22671428 2012 Magnesium and its transporters in cancer: a novel paradigm in tumour development.
22634382 2012 TRPM7: a unique channel involved in magnesium homeostasis.
22566504 2012 Pulsatile atheroprone shear stress affects the expression of transient receptor potential channels in human endothelial cells.
22460708 2012 Sensitivity of TRPM7 channels to Mg2+ characterized in cell-free patches of Jurkat T lymphocytes.
22323115 2012 Transient receptor potential melastatin-related 7 channel is overexpressed in human pancreatic ductal adenocarcinomas and regulates human pancreatic cancer cell migration.
22308955 2012 The role of transient receptor potential channel blockers in human gastric cancer cell viability.
22301056 2012 Detailed examination of Mg2+ and pH sensitivity of human TRPM7 channels.
22183257 2012 Silencing TRPM7 mimics the effects of magnesium deficiency in human microvascular endothelial cells.
22102510 2012 Modulation of transient receptor potential melastatin related 7 channel by presenilins.
21926172 2011 Waixenicin A inhibits cell proliferation through magnesium-dependent block of transient receptor potential melastatin 7 (TRPM7) channels.
21627970 2011 The Mg2+ transporter MagT1 partially rescues cell growth and Mg2+ uptake in cells lacking the channel-kinase TRPM7.
21443732 2011 Transient receptor potential melastatin 7 channels are involved in ginsenoside Rg3-induced apoptosis in gastric cancer cells.
21183474 2011 Transient receptor potential ion channel Trpm7 regulates exocrine pancreatic epithelial proliferation by Mg2+-sensitive Socs3a signaling in development and cancer.
21150127 2011 Transient receptor potential melastatin 7 (TRPM7) cation channels, magnesium and the vascular system in hypertension.
21122141 2010 The modulation of TRPM7 currents by nafamostat mesilate depends directly upon extracellular concentrations of divalent cations.
21112387 2011 The channel-kinase TRPM7 regulates phosphorylation of the translational factor eEF2 via eEF2-k.
20875900 2010 Gene variation of the transient receptor potential cation channel, subfamily M, members 6 (TRPM6) and 7 (TRPM7), and type 2 diabetes mellitus: a case-control study.
20075334 2010 TRPM7-mediated Ca2+ signals confer fibrogenesis in human atrial fibrillation.
20070945 2010 TRPM7 activates m-calpain by stress-dependent stimulation of p38 MAPK and c-Jun N-terminal kinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19998500 2009 Identification of TRPM7 channels in human intestinal interstitial cells of Cajal.
19644062 2009 Gene variation of the transient receptor potential cation channel, subfamily M, member 7 (TRPM7), and risk of incident ischemic stroke: prospective, nested, case-control study.
19515901 2009 Evidence that TRPM7 is required for breast cancer cell proliferation.
19454490 2009 Silencing TRPM7 promotes growth/proliferation and nitric oxide production of vascular endothelial cells via the ERK pathway.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19405049 2010 TRPM7 is not associated with amyotrophic lateral sclerosis-parkinsonism dementia complex in the Kii peninsula of Japan.
19149903 2009 Common genetic variants of the ion channel transient receptor potential membrane melastatin 6 and 7 (TRPM6 and TRPM7), magnesium intake, and risk of type 2 diabetes in women.
19145781 2009 Regulation of the novel Mg2+ transporter transient receptor potential melastatin 7 (TRPM7) cation channel by bradykinin in vascular smooth muscle cells.
19032368 2008 Suppression of transient receptor potential melastatin 7 channel induces cell death in gastric cancer.
18826101 2008 [Transient receptor potential melastatin 7 channel protein in human head and neck carcinoma cells and role in cell proliferation].
18719395 Molecular determinants of sensitivity and conductivity of human TRPM7 to Mg2+ and Ca2+.
18675813 2008 The alpha-kinases TRPM6 and TRPM7, but not eEF-2 kinase, phosphorylate the assembly domain of myosin IIA, IIB and IIC.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18390554 2008 Proton conductivity through the human TRPM7 channel and its molecular determinants.
18365021 2008 Massive autophosphorylation of the Ser/Thr-rich domain controls protein kinase activity of TRPM6 and TRPM7.
18301276 2008 Recent developments in intestinal magnesium absorption.
18192217 2008 Transient receptor potential melastatin 6 and 7 channels, magnesium transport, and vascular biology: implications in hypertension.
18073331 2008 Evolutionary determinants of divergent calcium selectivity of TRPM channels.
18006838 2007 Transient receptor potential melastatin 7-like current in human head and neck carcinoma cells: role in cell proliferation.
17823441 2007 The relation of magnesium and calcium intakes and a genetic polymorphism in the magnesium transporter to colorectal neoplasia risk.
17785843 2007 Functional transient receptor potential melastatin 7 channels are critical for human mast cell survival.
17646711 2007 Regulation of transient receptor potential melastatin 7 (TRPM7) currents by mitochondria.
17510191 2007 TRPM7 channel is sensitive to osmotic gradients in human kidney cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17310095 2007 Direct mechano-stress sensitivity of TRPM7 channel.
17217066 2007 The Mg2+ and Mg(2+)-nucleotide-regulated channel-kinase TRPM7.
17095511 2007 Activation of TRPM7 channels by phospholipase C-coupled receptor agonists.
16943238 2007 TRPM7 is a stretch- and swelling-activated cation channel involved in volume regulation in human epithelial cells.
16636202 2006 Functional characterization of homo- and heteromeric channel kinases TRPM6 and TRPM7.
16533898 2006 TRPM7 channel is regulated by magnesium nucleotides via its kinase domain.
16436382 2006 TRPM7 regulates cell adhesion by controlling the calcium-dependent protease calpain.
16407977 2006 TRPM7, a novel regulator of actomyosin contractility and cell adhesion.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16357306 2006 Functional TRPM7 channels accumulate at the plasma membrane in response to fluid flow.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16150690 2005 The channel kinases TRPM6 and TRPM7 are functionally nonredundant.
16075242 2005 Essential role for TRPM6 in epithelial magnesium transport and body magnesium homeostasis.
16051700 2005 A TRPM7 variant shows altered sensitivity to magnesium that may contribute to the pathogenesis of two Guamanian neurodegenerative disorders.
15781465 2005 Channel function is dissociated from the intrinsic kinase activity and autophosphorylation of TRPM7/ChaK1.
15591230 2005 Transient receptor potential melastatin 7 ion channels regulate magnesium homeostasis in vascular smooth muscle cells: role of angiotensin II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485879 2004 Phosphorylation of annexin I by TRPM7 channel-kinase.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15069188 2004 Receptor-mediated regulation of the TRPM7 channel through its endogenous protein kinase domain.
14976260 2004 Disruption of TRPM6/TRPM7 complex formation by a mutation in the TRPM6 gene causes hypomagnesemia with secondary hypocalcemia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594813 2004 Characterization of the protein kinase activity of TRPM7/ChaK1, a protein kinase fused to the transient receptor potential ion channel.
12887921 2003 Regulation of vertebrate cellular Mg2+ homeostasis by TRPM7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11941371 2002 The TRPM7 channel is inactivated by PIP(2) hydrolysis.
11385574 2001 LTRPC7 is a Mg.ATP-regulated divalent cation channel required for cell viability.
11161216 2001 TRP-PLIK, a bifunctional protein with kinase and ion channel activities.
10021370 1999 Alpha-kinases: a new class of protein kinases with a novel catalytic domain.