Property Summary

NCBI Gene PubMed Count 22
PubMed Score 83.39
PubTator Score 46.64

Knowledge Summary

Patent (11,595)

TINX Plot

  Disease (1)

Disease Target Count P-value
active Crohn's disease 918 2.9e-02

Expression

  Differential Expression (1)

Disease log2 FC p
active Crohn's disease -1.264 2.9e-02

Gene RIF (17)

PMID Text
26571400 The PKC-dependent effect of GLP-1 on membrane potential and electrical activity was mediated by activation of Na(+)-permeable TRPM4 and TRPM5 channels by mobilization of intracellular Ca(2+) from thapsigargin-sensitive Ca(2+) stores
26546534 Our results suggest roles of TRPM3 and TRPM5 gene variants in the susceptibility to or clinical expression of Systemic sclerosis
25967713 In a Turkish population, genetic polymorphism in TRPM5 genes modify individual susceptibility to metabolic syndrome.
24288162 TrpM5 expression was similar throughout the olfactory glomeruli.
24019741 The TRPM5 gene rs34551253 (Ala456Thr) polymorphism may be associated with increased risk of developing primary open angle glaucoma in the Turkish population.
23884414 extracellular Zn(2+) inhibits TRPM5 channels, and the residues in the outer pore loop of TRPM5 are critically involved in the inhibition.
23844940 AZIN1 rs2679757 and TRPM5 rs886277 are associated with the risk of HBV-related liver cirrhosis in Chinese.
23741618 TRPM5-mediated Na(+) entry to promote Ca(2+) uptake via an NCX to trigger MUC5AC secretion
21489577 common TRPM5 variants are likely to be associated with prediabetic phenotypes; and this may in turn contribute to the development of type 2 diabetes mellitus
21133676 results suggest TRPM5 may play a role in upregulating endogenous expression of TRPA1, that TRPA1 activation may be an additional trigger for co-expressed calcium-dependent ion channels such as TRPM5, and that TRPM5 may amplify responses to TRPA1 ligands
20660057 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
17217064 understanding the structural basis for TRPM5 function will ultimately allow the design of pharmaceuticals to enhance or interfere with taste sensations--{REVIEW}
15731110 data show that extracellular acidification acts through specific residues on transient receptor potential cation channel, subfamily M(TRPM5) to block conduction through two distinct but related mechanisms
14657398 regulation of TRPM5 by Ca2+ mediates sensory activation in the taste system
14634208 TRPM5 is a transient Ca2+-activated cation channel responding to rapid changes in [Ca2+]i
10607831 TRPM5 gene is imprinted, with preferential expression from the paternal allele.

AA Sequence

MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVS      1 - 70
LVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMA     71 - 140
SLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNLSHFILVEPGPPGKGDGLTELRLRLEKHISE    141 - 210
QRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEK    211 - 280
QFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLD    281 - 350
ELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYR    351 - 420
SVSRKSLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRGFYQDGRPGDR    421 - 490
RRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMSH    491 - 560
LETEAEAARATREAKYERLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHDGVQ    561 - 630
AFLTRIWWGDMAAGTPILRLLGAFLCPALVYTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRV    631 - 700
EELVEAPRAQGDRGPRAVFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVT    701 - 770
LYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPSAFEAGRTVLAM    771 - 840
DFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVL    841 - 910
YRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFLLVTNVLLMNLLIAMFSY    911 - 980
TFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHLSLTLRRVFKKEAEHKREHLERDLPDPLDQK    981 - 1050
VVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVA   1051 - 1120
DVLAQGGGPRSSQHCGEGSQLVAADHRGGLDGWEQPGAGQPPSDT                            1121 - 1165
//

Text Mined References (24)

PMID Year Title
26571400 2015 GLP-1 stimulates insulin secretion by PKC-dependent TRPM4 and TRPM5 activation.
26546534 Association of TRPM Channel Gene Polymorphisms with Systemic Sclerosis.
25967713 2015 Role of the transient receptor potential (TRP) channel gene expressions and TRP melastatin (TRPM) channel gene polymorphisms in obesity-related metabolic syndrome.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24288162 2014 Differential localization of NT-3 and TrpM5 in glomeruli of the olfactory bulb of mice.
24019741 2013 Association transient receptor potential melastatin channel gene polymorphism with primary open angle glaucoma.
23884414 2013 Extracellular zinc ion regulates transient receptor potential melastatin 5 (TRPM5) channel activation through its interaction with a pore loop domain.
23844940 2013 A candidate gene study for the association of host single nucleotide polymorphisms with liver cirrhosis risk in chinese hepatitis B patients.
23741618 2013 TRPM5-mediated calcium uptake regulates mucin secretion from human colon goblet cells.
21489577 2011 Genetic variation within the TRPM5 locus associates with prediabetic phenotypes in subjects at increased risk for type 2 diabetes.
21133676 2010 Overexpression of human transient receptor potential M5 upregulates endogenous human transient receptor potential A1 in a stable HEK cell line.
20660057 2010 Association between common variation in genes encoding sweet taste signaling components and human sucrose perception.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
17217064 2007 TRPM5 and taste transduction.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
15731110 2005 Extracellular acid block and acid-enhanced inactivation of the Ca2+-activated cation channel TRPM5 involve residues in the S3-S4 and S5-S6 extracellular domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14657398 2003 Intracellular Ca2+ and the phospholipid PIP2 regulate the taste transduction ion channel TRPM5.
14634208 2003 TRPM5 is a transient Ca2+-activated cation channel responding to rapid changes in [Ca2+]i.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368808 2002 A transient receptor potential channel expressed in taste receptor cells.
10915772 2000 Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse.
10607831 2000 Identification and characterization of MTR1, a novel gene with homology to melastatin (MLSN1) and the trp gene family located in the BWS-WT2 critical region on chromosome 11p15.5 and showing allele-specific expression.