Property Summary

NCBI Gene PubMed Count 51
PubMed Score 137.90
PubTator Score 108.73

Knowledge Summary

Patent (13,257)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.300 1.1e-05
medulloblastoma, large-cell -1.200 1.3e-05
intraductal papillary-mucinous adenoma (... 1.300 3.9e-03
ulcerative colitis -1.300 4.7e-05

Gene RIF (32)

PMID Text
26791488 TRPM4 channels regulate human detrusor smooth muscle excitability and contractility and are critical determinants of human urinary bladder function
26590985 TRPM4 protein expression is widely expressed in benign and cancerous prostate tissue
26571400 The PKC-dependent effect of GLP-1 on membrane potential and electrical activity was mediated by activation of Na(+)-permeable TRPM4 and TRPM5 channels by mobilization of intracellular Ca(2+) from thapsigargin-sensitive Ca(2+) stores
26496025 Identify TRPM4 as a regulator of store operated calcium entry in prostate tumor cells, and demonstrate a role for TRPM4 in cancer cell migration.
26172285 these data suggest an important role for the Sur1-Trpm4 channel in the pathophysiology of postischemic cell death
26110647 we demonstrate that the inhibition of TRPM4 activity alters cellular contractility in vivo, affecting cutaneous wound healing.
26071843 new insight into the ligand binding domains of the TRPM4 channel
25909699 TRPM4 acts to maintain endothelial features and its loss promotes fibrotic conversion via TGF-beta production.
25231975 Casein kinase 1 phosphorylates S839 and is responsible for the basolateral localization of TRPM4.
25047048 These results showed that the cell surface expression of TRPM4 channels is mediated by 14-3-3gamma binding.
25001294 TRPM4 is an important regulator of Ca2+ signals generated by histamine in hASCs and is required for adipogenesis.
24866019 Contraction of cerebral artery smooth muscle cells requires the integration of pressure-sensing signaling pathways and depolarization through the activation of TRPM4.
24518820 TRPM4 protein is a ROS-modulated non-selective cationic channel that performs several cell functions, including regulating intracellular Ca(2+) overload and Ca(2+) oscillation
24333049 Used the Xenopus laevis oocyte expression system for expression, purification and extraction of functional human TRPM4 protein. Investigated the supra-molecular assembly of TRPM4.
23796873 No role was found for TRPM4 in the peripheral blood compartment of multiple sclerosis patients.
23382873 Because of its effect on the resting membrane potential, reduction or increase of TRPM4 channel function may both reduce the availability of sodium channel and thus lead to Brugada syndrome .
23160238 TRPM4 cation channel mediates axonal and neuronal degeneration in experimental autoimmune encephalomyelitis and multiple sclerosis.
23116477 TRPM4 possesses the biophysical properties and upstream cellular signaling and regulatory pathways that establish it as a major physiological player in smooth muscle membrane depolarization.
21887725 In eight probands with atrioventricular block or right bundle branch block-five familial cases and three sporadic cases-a total of six novel and two published TRPM4 mutations were identified.
20884614 Cys(1093) residue of TRPM4 is crucial for the H(2)O(2)-mediated loss of desensitization.
20625999 These results identify TRPM4 as an important, unanticipated regulator of the beta-catenin pathway, where aberrant signaling is frequently associated with cancer.
20562447 TRPM4 gene is a causative gene in isolated cardiac conduction disease with mutations resulting in a gain of function and TRPM4 channel being highly expressed in cardiac Purkinje fibers.
19726882 In 3 branches of a large South African Afrikaner pedigree with an autosomal-dominant form of progressive familial heart block type I, identified the mutation c.19G-->A, which attenuated deSUMOylation of the TRPM4 channel.
19063936 Depolarizing currents generated by TRPM4 are an important component in the control of intracellular Ca(2+) signals necessary for insulin secretion and perhaps glucagon from alpha-cells.
18262493 This study is believed to provide the first clear evidence that TRPM4b interacts physically with TRPC3.
17217063 evidence indicates a role as a regulator of membrane potential, and thus the driving force for Ca2+ entry from the extracellular medium--{REVIEW}
16424899 PIP2 is a strong positive modulator of TRPM4 and implicate the C-terminal PH domain in PIP2 action.
16186107 hydrolysis of PI(4,5)P(2) underlies desensitization of TRPM4, and PI(4,5)P(2) is a general regulator for the gating of TRPM ion channels
15845551 analysis of selectivity filter of the cation channel TRPM4
15590641 the Ca(2+) sensitivity of TRPM4 is regulated by ATP, PKC-dependent phosphorylation, and calmodulin binding at the C terminus.
15550671 TRPM4-mediated depolarization modulates Ca2+ oscillations, with downstream effects on cytokine production in T lymphocytes
12799367 Voltage dependence is not due to block by divalent cations or to voltage-dependent binding of intracellular Ca2+ to an activator site, indicating that TRPM4 is a transient receptor potential channel with an intrinsic voltage-sensing mechanism.

AA Sequence

MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDAHTTEK      1 - 70
PTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRR     71 - 140
GLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTLINPKGSFPAR    141 - 210
YRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDG    211 - 280
DEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQ    281 - 350
VERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW    351 - 420
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPA    421 - 490
LKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLLSDKATSPLSLDAGLGQAPWS    491 - 560
DLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMARLEPDAEEAARRKDLAFKFEGMGVDLFGEC    561 - 630
YRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCP    631 - 700
PLIYTRLITFRKSEEEPTREELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLR    701 - 770
RWFHFWGAPVTIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL    771 - 840
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFMVFTVRLLHIF    841 - 910
TVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFPSILRRVFYRPYLQIFGQIPQ    911 - 980
EDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLIAMFSYTFGKV    981 - 1050
QGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERK   1051 - 1120
LLTWESVHKENFLLARARDKRESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVA   1121 - 1190
EALSRSALLPPGGPPPPDLPGSKD                                                 1191 - 1214
//

Text Mined References (51)

PMID Year Title
27207958 2016 Variants of Transient Receptor Potential Melastatin Member 4 in Childhood Atrioventricular Block.
26791488 2016 Novel regulatory mechanism in human urinary bladder: central role of transient receptor potential melastatin 4 channels in detrusor smooth muscle function.
26590985 2016 TRPM4 protein expression in prostate cancer: a novel tissue biomarker associated with risk of biochemical recurrence following radical prostatectomy.
26571400 2015 GLP-1 stimulates insulin secretion by PKC-dependent TRPM4 and TRPM5 activation.
26496025 2015 Transient receptor potential melastatin 4 channel contributes to migration of androgen-insensitive prostate cancer cells.
26172285 2015 Sur1-Trpm4 Cation Channel Expression in Human Cerebral Infarcts.
26110647 2015 TRPM4 Is a Novel Component of the Adhesome Required for Focal Adhesion Disassembly, Migration and Contractility.
26071843 2015 PIP2 and PIP3 interact with N-terminus region of TRPM4 channel.
25909699 2015 Suppression of transient receptor potential melastatin 4 expression promotes conversion of endothelial cells into fibroblasts via transforming growth factor/activin receptor-like kinase 5 pathway.
25231975 2015 Casein kinase-mediated phosphorylation of serine 839 is necessary for basolateral localization of the Ca²?-activated non-selective cation channel TRPM4.
25047048 2014 Depletion of 14-3-3? reduces the surface expression of Transient Receptor Potential Melastatin 4b (TRPM4b) channels and attenuates TRPM4b-mediated glutamate-induced neuronal cell death.
25001294 2014 Histamine-induced Ca²? signalling is mediated by TRPM4 channels in human adipose-derived stem cells.
24866019 2014 A PLC?1-dependent, force-sensitive signaling network in the myogenic constriction of cerebral arteries.
24518820 2015 Increases in reactive oxygen species enhance vascular endothelial cell migration through a mechanism dependent on the transient receptor potential melastatin 4 ion channel.
24333049 2014 Expression, purification, and projection structure by single particle electron microscopy of functional human TRPM4 heterologously expressed in Xenopus laevis oocytes.
23796873 2013 TRPM4 mRNA expression levels in peripheral blood mononuclear cells from multiple sclerosis patients.
23382873 2013 Molecular genetics and functional anomalies in a series of 248 Brugada cases with 11 mutations in the TRPM4 channel.
23160238 2012 TRPM4 cation channel mediates axonal and neuronal degeneration in experimental autoimmune encephalomyelitis and multiple sclerosis.
23116477 2013 Regulation of cerebral artery smooth muscle membrane potential by Ca²?-activated cation channels.
21887725 2012 Mutational spectrum in the Ca(2+)--activated cation channel gene TRPM4 in patients with cardiac conductance disturbances.
20884614 2010 Hydrogen peroxide removes TRPM4 current desensitization conferring increased vulnerability to necrotic cell death.
20656926 2010 Trpm4 differentially regulates Th1 and Th2 function by altering calcium signaling and NFAT localization.
20625999 2011 TRPM4 enhances cell proliferation through up-regulation of the ?-catenin signaling pathway.
20562447 2010 Gain-of-function mutations in TRPM4 cause autosomal dominant isolated cardiac conduction disease.
19945433 2010 Cloning and characterization of rat transient receptor potential-melastatin 4 (TRPM4).
19726882 2009 Impaired endocytosis of the ion channel TRPM4 is associated with human progressive familial heart block type I.
19063936 2009 TRPM4 impacts on Ca2+ signals during agonist-induced insulin secretion in pancreatic beta-cells.
18262493 2008 TRPM4b channel suppresses store-operated Ca2+ entry by a novel protein-protein interaction with the TRPC3 channel.
17288552 2007 Modulation of Ca2+ entry and plasma membrane potential by human TRPM4b.
17217063 2007 Insights into TRPM4 function, regulation and physiological role.
16806463 2007 TRPM4 controls insulin secretion in pancreatic beta-cells.
16777713 2006 Tissue distribution profiles of the human TRPM cation channel family.
16424899 2006 The Ca2+-activated cation channel TRPM4 is regulated by phosphatidylinositol 4,5-biphosphate.
16407466 2006 A pyrazole derivative potently inhibits lymphocyte Ca2+ influx and cytokine production by facilitating transient receptor potential melastatin 4 channel activity.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16186107 2005 Phosphatidylinositol 4,5-bisphosphate rescues TRPM4 channels from desensitization.
15845551 2005 The selectivity filter of the cation channel TRPM4.
15590641 2005 Regulation of the Ca2+ sensitivity of the nonselective cation channel TRPM4.
15550671 2004 TRPM4 regulates calcium oscillations after T cell activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472118 2004 Critical role for transient receptor potential channel TRPM4 in myogenic constriction of cerebral arteries.
15331675 2004 Decavanadate modulates gating of TRPM4 cation channels.
15121803 2004 Functional characterization of a Ca(2+)-activated non-selective cation channel in human atrial cardiomyocytes.
14758478 2004 Intracellular nucleotides and polyamines inhibit the Ca2+-activated cation channel TRPM4b.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842017 2003 TRPM5 is a voltage-modulated and Ca(2+)-activated monovalent selective cation channel.
12799367 2003 Voltage dependence of the Ca2+-activated cation channel TRPM4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015988 2002 TRPM4 is a Ca2+-activated nonselective cation channel mediating cell membrane depolarization.
11535825 2001 Regulation of melastatin, a TRP-related protein, through interaction with a cytoplasmic isoform.