Property Summary

NCBI Gene PubMed Count 91
PubMed Score 21.63
PubTator Score 191.15

Knowledge Summary

Patent (17,620)

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 266
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Fascioliasis 18 3.28 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.300 9.5e-11
glioblastoma -1.100 1.2e-08
group 4 medulloblastoma -1.900 4.2e-09
atypical teratoid/rhabdoid tumor -1.600 2.0e-13
medulloblastoma, large-cell -1.300 1.5e-04
primitive neuroectodermal tumor -1.300 3.4e-05
lung adenocarcinoma 1.400 1.3e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2770 screening 0 / 0 / 3 Late stage counterscreen results from the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): other ion channel Fura-2 profiling assay

Gene RIF (80)

PMID Text
26656285 Data show that HEK293 cells expressing low levels of receptor potential melastatin 2 (TRPM2) channel were more susceptible to silica nanoparticles (NPs) than those expressing high levels of TRPM2.
26558786 In a transgenic mouse model of Alzheimer's disease, TRPM2 was involved in neuronal toxicity and memory impairment.
26311765 TRPM2 actively regulates the phosphorylation of GSK-3 in the brain.
26178079 This is expected to provide a basis for inhibiting TRPM2 for the improved treatment of breast cancer, which potentially includes treating breast tumors that are resistant to chemotherapy due to their evasion of apoptosis.
25760728 The HDACi-elicited upregulation of TRPM2 expression.
25760245 we report here a novel effect promoted by TRPM2, where it functions to minimize DNA damage and thus may have a role in the protection of genomic DNA in breast cancer cells.
25675998 VEGF-induced angiogenesis required reactive oxygen species generation in endothelial cells and resultant TRPM2 activation.
25620041 These findings shed new light on the evolution of TRPM2 and establish nvTRPM2 as a promising tool to decipher its complex gating mechanisms.
25576627 Ca2+ entry via Trpm2 channels was essential for maintenance of mitochondrial function in the heart.
25391657 TRPM2-L function may be a novel approach to reduce tumor growth through modulation of HIF-1/2a, mitochondrial function, and mitophagy.
25084624 Although further analyses are needed to clarify the mechanism underlying TRPM2-mediated insulin secretion, TRPM2 could be a key player in the regulation of insulin secretion and could represent a new target for diabetes therapy
24931166 TRPM2-AS knockdown led to prostate cancer apoptosis, with a transcriptional profile indicating an increase in cellular stress, which was coupled to cell cycle arrest, an increase in intracellular hydrogen peroxide and activation of the sense TRPM2 gene.
24337049 Preventing the uncoupling of short variant TRPM2-S from TRPM2 and subsequent calcium gating during oxidative stress mitigates endothelial apoptosis and its consequences in mediating vascular injury and inflammation.
24004350 Recent scientific advance on the mechanistic study of gout-associated inflammation is discussed and the potential of targeting the transient receptor potential melastatin 2 is highlighted as a novel therapeutic approach for the treatment of gout
23957292 the crucial role of a positively charged amino acid residue at position 1110 for TRPM2 channel activity
23910495 TRPM7 plays a critical role in breast cancer cell migration through its kinase domain.
23629676 The degradation of zonula occludens-1 (ZO-1), and claudin-2 exhibited a great dependence on the activation of the transient receptor potential melastatin (TRPM) 2 channel, phospholipase Cgamma1 (PLCgamma1) and the protein kinase Calpha (PKCalpha) signaling cascade.
23458684 the activation of TRPM2 channel, which mediates ATP release, and TRPV1 channel plays significant roles in the cellular responses to DNA damage induced by gamma-irradiation and UVB irradiation.
23443543 TRPM2 is activated by irradiation, via PARP1 activation, and contributes to irreversible loss of salivary gland function.
23302782 overexpression of TRPM2-S results in increased proliferation through phosphatidylinositol 3-kinase/Akt and ERK pathways, while overexpression of TRPM2-L confers protection against oxidative stress-induced cell death through FOXO3a and SOD
23277130 The association with bipolar disorder of the iPLA2beta (PLA2G6) its genetic interaction with type 2 transient receptor potential channel gene TRPM2, was examined.
23185472 In conclusion, the N-x-x-D motif plays specific roles in TRPM8 and TRPM2, reflecting different requirements for voltage-dependent and voltage-independent channel gating.
23142700 TRPM2 mRNA expression in endometrial stromal cells increased after 17beta-estradiol exposure.
22931549 Particulate matter induces marked increases in vascular permeability via ROS-mediated calcium leakage via activated TRPM2, and via ZO-1 degradation by activated calpain.
22750002 Cu2+ is a potent TRPM2 channel blocker. The sensitivity of TRPM2 channel to heavy metal ions could be a new mechanism for the pathogenesis of some metal ion-related diseases.
22547068 the changes of Ca(2+) homeostasis induced by NAD(+) precursors are mediated by CD38 and the consequent ADPR-mediated TRPM2 gating.
22493272 findings suggest that redox signals sensitize TRPM2 downstream of NADPH oxidase activity and make TRPM2 active at physiological body temperature, leading to increased cytosolic Ca(2+) concentrations
22226147 The juvenile myoclonic epilepsy-related protein EFHC1 interacts with the redox-sensitive TRPM2 channel linked to cell death.
21602277 Zn(2+) inactivates the TRPM2 channels and that residues in the outer pore are critical determinants of the inactivation.
21505784 Results suggest a crucial role of residue His(995)/Gln(992) in the outer pore of TRPM2 channels in determining species-dependent effects of extracellular acidic pH.
21193737 TRP channels in the beta-cell may integrate a variety of stimuli to modulate glucose-stimulated electrical and calcium responsiveness.
20799912 Our findings suggest that the elevation of [Na(+)](in) and [Ca(2+)](in) induced ONP apoptosis and altered the expression of TRPM2. Lithium pretreatment attenuated the apoptosis induced by ionic stress.
20660597 acidic pH acts as a negative feedback mechanism where protons bind to the outer vestibule of the TRPM2 channel pore and inhibit the TRPM2 channels in a state-dependent manner.
20650899 Identification of direct and indirect effectors of the transient receptor potential melastatin 2 (TRPM2) cation channel.
20587417 the gating processes in TRPM2 and TRPM8 differ in their requirements for specific structures within the pore.
20515676 found no evidence for an association of the TRPM2 variants tested with type 2 diabetes mellitus, although HOMA-%B was negatively associated with three TRPM2 variants
20515676 Observational study of gene-disease association. (HuGE Navigator)
20237295 Enhancement of azurophil granule-phagosome fusion via glycine receptor alpha 2 subunit (GlyRalpha2)/transient receptor potential melastatin (TRPM)2/p38 MAP kinase signaling is a novel target for enhancement of neutrophil bactericidal activity.
20194125 The calcium-permeable non-selective cation channel TRPM2 is modulated by cellular acidification.
20107186 Data demonstrate that TRPM2 is required for the LPS-induced production of IL-6, IL-8, IL-10, and TNF-alpha.
20029400 TRPM2 is essential for prostate cancer cell proliferation and may be a potential target for the selective treatment of prostate cancer.
19887679 [REVIEW] TRPM1 and TRPM2, are localized in intracellular compartments and are involved in melanin synthesis and oxidative stress-induced cell death
19749482 Its activation by oxidative stress leads to chemokine production in macrophage, which causes chronic inflammation. (review)
19652898 These results collectively suggest the requirement for the N-terminal CC domain for protein expression and function, but not subunit interaction, of the TRPM2 channel.
19454650 Data show that TRPM2 and ADPR represent multimodal signaling elements regulating Ca2+ mobilization in beta cells through membrane depolarization, Ca2+ influx, and release of Ca2+ from intracellular stores.
19382906 functional TRPM2 channels mediate H(2)O(2)-induced Ca(2+) entry in beta-cells, a process potently inhibited by N-(p-amylcinnamoyl)anthranilic acid
19133961 This study supports a role for TRPM2 in the pathogenesis of bipolar disorder and the G allele of rs1556314 at exon 11 of TRPM2 in BD-I but not bipolar disorder type II (BD-II).
19133961 Observational study of gene-disease association. (HuGE Navigator)
19004782 A variant of the transient receptor potential melastatin 2 (TRPM2) gene may confer susceptibility to parkinsonism-dementia and amyotrophic lateral sclerosis.
18957938 Study describes the computational identification of a melanoma-enriched antisense transcript, TRPM2-AS, mapped within the locus of TRPM2, an ion channel capable of mediating susceptibility to cell death
18687688 that Glu-960, Gln-981, Asp-987, and Glu-1022 residues are engaged in determining divalent cationic permeation properties of the TRPM2 channel.
18599483 during conditions of oxidative stress in lymphocytes, TRPM2 acts as a downstream effector of the PARP/poly(ADP-ribose) glycohydrolase pathway through PARP-dependent formation of ADP-ribose.
18572241 The regulation of TRPM2 activation in human neutrophils, is characterized.
18048770 TRPM2 mediates H2O2-induced increase in endothelial permeability through the activation of Ca2+ entry via TRPM2.
17940282 TRPM2 agonist-binding ADPRase domain and the ion gate in the transmembrane region are separately located in the molecule.
17604279 the transmembrane segment S6 has a role in determining cation versus anion selectivity of TRPM2 and TRPM8
17525977 Observational study of gene-disease association. (HuGE Navigator)
17251321 Tyrosine phosphorylation of TRPM2 by PTPL1 controls activation/function.
17217061 in light of the wide-spread expression and growing list of cellular functions of TRPM2, useful therapeutic applications are expected for future drugs that block TRPM2 channels or inhibit their activation--{REVIEW}
17060318 examined role of a coiled-coil domain in the intracellular C terminus of TRPM2 subunit in subunit interaction and channel assembly
16822940 These results taken together suggest that the cysteine residues in the pore region are obligatory for TRPM2 channel function.
16777714 detailed expression profile of TRPM2 mRNA within the central nervous system
16733555 Screening of bipolar affective disorder patients for mutations in TRPM2 led to identification of three novel and four known transitions, indicating TRPM2 as a candidate gene of bipolar affective disorder.
16719842 ADP-ribose and Ca2+ in concert behave as a messenger system for agonist-induced influx of Ca2+ through TRPM2 in granulocytes
16601673 TRPM2 is a potential molecular target for cADPR, which regulates Ca(2+) entry into pancreatic beta-cells at body temperature depending on the production of cADPR-related molecules, thereby regulating insulin secretion.
16585058 Cyclic ADP-ribose and NAADP strongly activate natively expressed TRPM2 chanels in Jurkat T cells.
16565078 a SIR2 reaction metabolite modulates TRPM2 ion channel
16461353 data demonstrate the requirement for CaM in TRPM2 activation; they suggest that Ca(2+) entering through TRPM2 enhances interaction of CaM with TRPM2 at the IQ-like motif in the N terminus, providing crucial positive feedback for channel activation
16316998 gene silencing of TRPM2 abolished the adenosine diphosphoribose - and ConA-mediated inward current.
16306129 Data show that one mechanism through which oxidative stress or TNF-alpha mediates cell death is activation of TRPM2, resulting in increased internal calcium, followed by caspase activation and PARP cleavage.
16252251 Observational study of gene-disease association. (HuGE Navigator)
16252251 Findings suggest genetic variants of the TRPM2 gene increase risk for BD and support the notion that TRPM2 may be involved in the pathophysiology of bipolar disorder.
16075382 LTRPC2 protein is a likely component of the calcium release activated nonselective cation channel in lymphocytes
15808509 TRPM2 is a coincidence detector for adenosine diphosphatae ribose and cyclic adp ribose signaling.
15708008 The SSF-TRPM2 protein still maintained H2(O2)-induced Ca2+ influx activity. In addition, we found that the major transcripts in human and mouse start from a novel 5' non-coding exon; we could not detect any striatum short transcript in mouse brain.
15561722 oxidative and nitrosative stress induces TRPM2 activation in which mitochondria are induced to produce free ADP-ribose and release it to the cytosol, where its subsequent accumulation induces TRPM2 gating
12594222 TRPM2-S is an important physiologic isoform of TRPM2 and modulates channel activity and induction of cell death by oxidative stress through TRPM2-L.
12564954 evidence of role in neutrophil granulocytes by forming an entry pathway for Na(+) and Ca(2+), which is regulated by ADP-ribose and the redox state
12529379 channel acitvation is dependent on criticial intracellular Ca2+
11804595 LTRPC2 represents an important intrinsic mechanism that mediates Ca2+ and Na+ overload in response to disturbance of redox state in cell death

AA Sequence

MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLSSWIPENIKKK      1 - 70
ECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVK     71 - 140
KYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGS    141 - 210
HTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSN    211 - 280
HSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPC    281 - 350
VVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR    351 - 420
EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTA    421 - 490
ALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHH    491 - 560
VAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAI    561 - 630
VQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEER    631 - 700
AQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGL    701 - 770
ISFREKRLQDVGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV    771 - 840
CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILSLDFILFCLRL    841 - 910
MHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFG    911 - 980
QIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLLNLLIAMFNY    981 - 1050
TFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAA   1051 - 1120
LLSWEIYLKENYLQNRQFQQKQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQA   1121 - 1190
LHWIVRTLRASGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE   1191 - 1260
KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPLNPMGR   1261 - 1330
TGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLPLSEHWALPGGSREPGEMLPR   1331 - 1400
KLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSG   1401 - 1470
ASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY                                        1471 - 1503
//

Text Mined References (94)

PMID Year Title
27383051 2016 The proposed channel-enzyme transient receptor potential melastatin 2 does not possess ADP ribose hydrolase activity.
27068538 2016 Reciprocal regulation of actin cytoskeleton remodelling and cell migration by Ca2+ and Zn2+: role of TRPM2 channels.
26656285 2015 A dual role of transient receptor potential melastatin 2 channel in cytotoxicity induced by silica nanoparticles.
26558786 2015 The Transient Receptor Potential Melastatin 2 (TRPM2) Channel Contributes to ?-Amyloid Oligomer-Related Neurotoxicity and Memory Impairment.
26311765 2015 TRPM2, a Susceptibility Gene for Bipolar Disorder, Regulates Glycogen Synthase Kinase-3 Activity in the Brain.
26178079 2015 Enhanced cytotoxicity in triple-negative and estrogen receptor?positive breast adenocarcinoma cells due to inhibition of the transient receptor potential melastatin-2 channel.
25918360 2015 Ruling out pyridine dinucleotides as true TRPM2 channel activators reveals novel direct agonist ADP-ribose-2'-phosphate.
25760728 2015 TRPM2 mediates histone deacetylase inhibition-induced apoptosis in bladder cancer cells.
25760245 2015 Inhibition of the transient receptor potential melastatin-2 channel causes increased DNA damage and decreased proliferation in breast adenocarcinoma cells.
25675998 2015 Novel role of reactive oxygen species-activated Trp melastatin channel-2 in mediating angiogenesis and postischemic neovascularization.
25620041 2015 Functional characterisation of a TRPM2 orthologue from the sea anemone Nematostella vectensis in human cells.
25576627 2015 Ca²? entry via Trpm2 is essential for cardiac myocyte bioenergetics maintenance.
25562606 2015 TRPM2-mediated intracellular Zn2+ release triggers pancreatic ?-cell death.
25391657 2014 A splice variant of the human ion channel TRPM2 modulates neuroblastoma tumor growth through hypoxia-inducible factor (HIF)-1/2?.
25084624 2014 The role of TRPM2 in pancreatic ?-cells and the development of diabetes.
24931166 2015 Antisense transcription at the TRPM2 locus as a novel prognostic marker and therapeutic target in prostate cancer.
24337049 2014 Cooperative interaction of trp melastatin channel transient receptor potential (TRPM2) with its splice variant TRPM2 short variant is essential for endothelial cell apoptosis.
24004350 2013 Transient receptor potential melastatin 2: a novel target for treatment of gout.
23957292 2013 Lys1110 of TRPM2 is critical for channel activation.
23910495 2013 Transient receptor potential melastatin 7 is involved in oestrogen receptor-negative metastatic breast cancer cells migration through its kinase domain.
23629676 2013 Oxidative stress mediates the disruption of airway epithelial tight junctions through a TRPM2-PLC?1-PKC? signaling pathway.
23458684 2013 Role of TRPM2 and TRPV1 cation channels in cellular responses to radiation-induced DNA damage.
23443543 2013 Loss of TRPM2 function protects against irradiation-induced salivary gland dysfunction.
23302782 2013 Role of TRPM2 in cell proliferation and susceptibility to oxidative stress.
23277130 2013 Association of the iPLA2? gene with bipolar disorder and assessment of its interaction with TRPM2 gene polymorphisms.
23185472 2012 Importance of a conserved sequence motif in transmembrane segment S3 for the gating of human TRPM8 and TRPM2.
23142700 2013 Expression and regulation of transient receptor potential cation channel, subfamily M, member 2 (TRPM2) in human endometrium.
22931549 2012 Particulate matter air pollution disrupts endothelial cell barrier via calpain-mediated tight junction protein degradation.
22750002 2012 Divalent copper is a potent extracellular blocker for TRPM2 channel.
22547068 2012 NAD+ levels control Ca2+ store replenishment and mitogen-induced increase of cytosolic Ca2+ by Cyclic ADP-ribose-dependent TRPM2 channel gating in human T lymphocytes.
22493272 2012 Redox signal-mediated sensitization of transient receptor potential melastatin 2 (TRPM2) to temperature affects macrophage functions.
22226147 2012 The juvenile myoclonic epilepsy-related protein EFHC1 interacts with the redox-sensitive TRPM2 channel linked to cell death.
21602277 2011 Zinc inactivates melastatin transient receptor potential 2 channels via the outer pore.
21505784 2011 A residue in the TRPM2 channel outer pore is crucial in determining species-dependent sensitivity to extracellular acidic pH.
21193737 2011 TRP-ing down the path to insulin secretion.
20799912 2010 Effect of ionic stress on apoptosis and the expression of TRPM2 in human olfactory neuroepithelial-derived progenitors.
20660597 2010 State-dependent inhibition of TRPM2 channel by acidic pH.
20650899 2010 Identification of direct and indirect effectors of the transient receptor potential melastatin 2 (TRPM2) cation channel.
20587417 2010 Contribution of the S5-pore-S6 domain to the gating characteristics of the cation channels TRPM2 and TRPM8.
20515676 2010 Gene variation of the transient receptor potential cation channel, subfamily M, member 2 (TRPM2) and type 2 diabetes mellitus: A case-control study.
20237295 2010 Lysophosphatidylcholine increases neutrophil bactericidal activity by enhancement of azurophil granule-phagosome fusion via glycine.GlyR alpha 2/TRPM2/p38 MAPK signaling.
20194125 2010 The calcium-permeable non-selective cation channel TRPM2 is modulated by cellular acidification.
20107186 2010 Transient receptor potential melastatin 2 is required for lipopolysaccharide-induced cytokine production in human monocytes.
20029400 2010 Novel role for the transient receptor potential channel TRPM2 in prostate cancer cell proliferation.
19887679 2009 In with the TRP channels: intracellular functions for TRPM1 and TRPM2.
19749482 2009 Involvement of TRPM2 channel in amplification of reactive oxygen species-induced signaling and chronic inflammation.
19652898 2009 Requirement for the N-terminal coiled-coil domain for expression and function, but not subunit interaction of, the ADPR-activated TRPM2 channel.
19454650 2009 TRPM2 functions as a lysosomal Ca2+-release channel in beta cells.
19382906 2009 H2O2-induced Ca2+ influx and its inhibition by N-(p-amylcinnamoyl) anthranilic acid in the beta-cells: involvement of TRPM2 channels.
19171771 2009 Four Ca2+ ions activate TRPM2 channels by binding in deep crevices near the pore but intracellularly of the gate.
19133961 2009 TRPM2 variants and bipolar disorder risk: confirmation in a family-based association study.
19004782 2008 Altered functional properties of a TRPM2 variant in Guamanian ALS and PD.
18957938 2008 Identification of novel sense and antisense transcription at the TRPM2 locus in cancer.
18687688 2008 Identification of pore residues engaged in determining divalent cationic permeation in transient receptor potential melastatin subtype channel 2.
18599483 2008 The Poly(ADP-ribose) polymerase PARP-1 is required for oxidative stress-induced TRPM2 activation in lymphocytes.
18572241 2008 Synergistic regulation of endogenous TRPM2 channels by adenine dinucleotides in primary human neutrophils.
18048770 2008 Role of TRPM2 channel in mediating H2O2-induced Ca2+ entry and endothelial hyperpermeability.
17940282 2007 Three-dimensional reconstruction using transmission electron microscopy reveals a swollen, bell-shaped structure of transient receptor potential melastatin type 2 cation channel.
17604279 2007 The transmembrane segment S6 determines cation versus anion selectivity of TRPM2 and TRPM8.
17525977 2007 Candidate gene analysis of 21q22: support for S100B as a susceptibility gene for bipolar affective disorder with psychosis.
17251321 2007 Regulation of TRP channel TRPM2 by the tyrosine phosphatase PTPL1.
17217061 2007 TRPM2.
17060318 2006 Intracellular coiled-coil domain engaged in subunit interaction and assembly of melastatin-related transient receptor potential channel 2.
16822940 2006 Conserved cysteine residues in the pore region are obligatory for human TRPM2 channel function.
16777714 2006 TRPM2 is elevated in the tMCAO stroke model, transcriptionally regulated, and functionally expressed in C13 microglia.
16733555 2006 Screening of chromosomal region 21q22.3 for mutations in genes associated with neuronal Ca2+ signalling in bipolar affective disorder.
16719842 2006 Endogenous ADP-ribose enables calcium-regulated cation currents through TRPM2 channels in neutrophil granulocytes.
16601673 2006 TRPM2 activation by cyclic ADP-ribose at body temperature is involved in insulin secretion.
16585058 2006 Nicotinic acid adenine dinucleotide phosphate and cyclic ADP-ribose regulate TRPM2 channels in T lymphocytes.
16565078 2006 Metabolite of SIR2 reaction modulates TRPM2 ion channel.
16461353 2006 Regulation of the transient receptor potential channel TRPM2 by the Ca2+ sensor calmodulin.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16316998 2006 Activation of T cell calcium influx by the second messenger ADP-ribose.
16306129 2006 TRPM2 is an ion channel that modulates hematopoietic cell death through activation of caspases and PARP cleavage.
16260005 2006 Characterisation of recombinant rat TRPM2 and a TRPM2-like conductance in cultured rat striatal neurones.
16252251 2006 Association of the putative susceptibility gene, transient receptor potential protein melastatin type 2, with bipolar disorder.
16075382 2005 A store-operated nonselective cation channel in human lymphocytes.
15808509 2005 Cyclic ADP-ribose and hydrogen peroxide synergize with ADP-ribose in the activation of TRPM2 channels.
15708008 2005 Characterization of human and mouse TRPM2 genes: identification of a novel N-terminal truncated protein specifically expressed in human striatum.
15561722 2005 Accumulation of free ADP-ribose from mitochondria mediates oxidative stress-induced gating of TRPM2 cation channels.
12594222 2003 A novel TRPM2 isoform inhibits calcium influx and susceptibility to cell death.
12564954 2003 Expression profile of the transient receptor potential (TRP) family in neutrophil granulocytes: evidence for currents through long TRP channel 2 induced by ADP-ribose and NAD.
12529379 2003 Critical intracellular Ca2+ dependence of transient receptor potential melastatin 2 (TRPM2) cation channel activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377790 2002 Selective association of TRPC channel subunits in rat brain synaptosomes.
12032305 2002 Subunit composition of mammalian transient receptor potential channels in living cells.
11960981 2002 Activation of the cation channel long transient receptor potential channel 2 (LTRPC2) by hydrogen peroxide. A splice variant reveals a mode of activation independent of ADP-ribose.
11804595 2002 LTRPC2 Ca2+-permeable channel activated by changes in redox status confers susceptibility to cell death.
11509734 2001 Immunocyte Ca2+ influx system mediated by LTRPC2.
11385575 2001 ADP-ribose gating of the calcium-permeable LTRPC2 channel revealed by Nudix motif homology.
11290752 2001 Identification of common binding sites for calmodulin and inositol 1,4,5-trisphosphate receptors on the carboxyl termini of trp channels.
10830953 2000 The DNA sequence of human chromosome 21.
9806837 1998 Molecular cloning of a novel putative Ca2+ channel protein (TRPC7) highly expressed in brain.
9179495 1997 Localization of 16 exons to a 450-kb region involved in the autoimmune polyglandular disease type I (APECED) on human chromosome 21q22.3.